Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-YefM |
Location | 2093671..2094386 | Replicon | chromosome |
Accession | NZ_CP115971 | ||
Organism | Actinobacillus pleuropneumoniae strain HBS1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PE794_RS10005 | Protein ID | WP_005599445.1 |
Coordinates | 2093671..2094036 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | B0BT01 |
Locus tag | PE794_RS10010 | Protein ID | WP_005599447.1 |
Coordinates | 2094099..2094386 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PE794_RS09990 (PE794_09990) | 2089256..2090962 | - | 1707 | WP_005599433.1 | bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase | - |
PE794_RS09995 (PE794_09995) | 2091058..2091339 | - | 282 | WP_005599441.1 | DNA-directed RNA polymerase subunit omega | - |
PE794_RS10000 (PE794_10000) | 2091466..2093547 | - | 2082 | WP_005599444.1 | ATP-dependent DNA helicase RecG | - |
PE794_RS10005 (PE794_10005) | 2093671..2094036 | - | 366 | WP_005599445.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PE794_RS10010 (PE794_10010) | 2094099..2094386 | - | 288 | WP_005599447.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PE794_RS10015 (PE794_10015) | 2094592..2096307 | + | 1716 | WP_005599448.1 | proline--tRNA ligase | - |
PE794_RS10020 (PE794_10020) | 2096373..2096561 | - | 189 | WP_005602684.1 | hypothetical protein | - |
PE794_RS10025 (PE794_10025) | 2096564..2097145 | - | 582 | WP_005599450.1 | sigma-70 family RNA polymerase sigma factor | - |
PE794_RS10030 (PE794_10030) | 2097234..2098190 | + | 957 | WP_005619040.1 | protein-methionine-sulfoxide reductase catalytic subunit MsrP | - |
PE794_RS10035 (PE794_10035) | 2098190..2098783 | + | 594 | WP_005599453.1 | protein-methionine-sulfoxide reductase heme-binding subunit MsrQ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13974.06 Da Isoelectric Point: 9.0549
>T267563 WP_005599445.1 NZ_CP115971:c2094036-2093671 [Actinobacillus pleuropneumoniae]
MDTNVRQWLATIKPSQTNISCITLSEIKTGILLKARKDPIQAERLNHWFTHNVLSVYQAKSFSINNEIALLASEYHIPNK
MDLNDAYIAATAKYHNLVLVTRNLKDFNRCDIRLFNPFEPN
MDTNVRQWLATIKPSQTNISCITLSEIKTGILLKARKDPIQAERLNHWFTHNVLSVYQAKSFSINNEIALLASEYHIPNK
MDLNDAYIAATAKYHNLVLVTRNLKDFNRCDIRLFNPFEPN
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|