Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 2010540..2011168 | Replicon | chromosome |
Accession | NZ_CP115971 | ||
Organism | Actinobacillus pleuropneumoniae strain HBS1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PE794_RS09500 | Protein ID | WP_005599242.1 |
Coordinates | 2010770..2011168 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A828PGB0 |
Locus tag | PE794_RS09495 | Protein ID | WP_005599241.1 |
Coordinates | 2010540..2010770 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PE794_RS09485 (PE794_09485) | 2008513..2010099 | + | 1587 | WP_005599240.1 | DUF262 domain-containing protein | - |
PE794_RS09490 (PE794_09490) | 2010292..2010465 | - | 174 | Protein_1826 | addiction module antidote protein, HigA family | - |
PE794_RS09495 (PE794_09495) | 2010540..2010770 | + | 231 | WP_005599241.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
PE794_RS09500 (PE794_09500) | 2010770..2011168 | + | 399 | WP_005599242.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
PE794_RS09505 (PE794_09505) | 2011303..2011719 | - | 417 | WP_005599244.1 | DUF417 family protein | - |
PE794_RS09510 (PE794_09510) | 2011956..2013146 | - | 1191 | WP_005599245.1 | pentapeptide repeat-containing protein | - |
PE794_RS09515 (PE794_09515) | 2013199..2014521 | - | 1323 | WP_005620148.1 | HslU--HslV peptidase ATPase subunit | - |
PE794_RS09520 (PE794_09520) | 2014667..2015188 | - | 522 | WP_005599247.1 | ATP-dependent protease subunit HslV | - |
PE794_RS09525 (PE794_09525) | 2015266..2015977 | - | 712 | Protein_1833 | DNA/RNA nuclease SfsA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1995161..2013146 | 17985 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15028.31 Da Isoelectric Point: 7.4716
>T267562 WP_005599242.1 NZ_CP115971:2010770-2011168 [Actinobacillus pleuropneumoniae]
MLTYMLDTNIAIYVIKRRPLEVLDKFNLNSTRLCVSSITAAELYYGAEKSQFPEQNMAVIEDFLSRLTILDYTHKAATHF
GNIKAHLSKHGKIIGENDIHIAAHARSEGLVLVTNNLREFERVEGLRLANWV
MLTYMLDTNIAIYVIKRRPLEVLDKFNLNSTRLCVSSITAAELYYGAEKSQFPEQNMAVIEDFLSRLTILDYTHKAATHF
GNIKAHLSKHGKIIGENDIHIAAHARSEGLVLVTNNLREFERVEGLRLANWV
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|