Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1797112..1797843 | Replicon | chromosome |
| Accession | NZ_CP115971 | ||
| Organism | Actinobacillus pleuropneumoniae strain HBS1 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | PE794_RS08430 | Protein ID | WP_005598840.1 |
| Coordinates | 1797112..1797579 (-) | Length | 156 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | B0BRD3 |
| Locus tag | PE794_RS08435 | Protein ID | WP_005619269.1 |
| Coordinates | 1797583..1797843 (-) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PE794_RS08405 (PE794_08405) | 1792471..1792842 | - | 372 | WP_005598830.1 | CrcB family protein | - |
| PE794_RS08410 (PE794_08410) | 1792845..1793909 | - | 1065 | WP_043991897.1 | MFS transporter | - |
| PE794_RS08415 (PE794_08415) | 1794004..1795113 | + | 1110 | WP_005598834.1 | anhydro-N-acetylmuramic acid kinase | - |
| PE794_RS08420 (PE794_08420) | 1795167..1796081 | + | 915 | WP_005598836.1 | N-acetylmuramic acid 6-phosphate etherase | - |
| PE794_RS08425 (PE794_08425) | 1796148..1797029 | - | 882 | WP_005598838.1 | 50S ribosomal protein L11 methyltransferase | - |
| PE794_RS08430 (PE794_08430) | 1797112..1797579 | - | 468 | WP_005598840.1 | GNAT family N-acetyltransferase | Toxin |
| PE794_RS08435 (PE794_08435) | 1797583..1797843 | - | 261 | WP_005619269.1 | DUF1778 domain-containing protein | Antitoxin |
| PE794_RS08440 (PE794_08440) | 1797964..1799424 | - | 1461 | WP_005598844.1 | metalloprotease TldD | - |
| PE794_RS08445 (PE794_08445) | 1799554..1800813 | + | 1260 | WP_005598846.1 | tRNA lysidine(34) synthetase TilS | - |
| PE794_RS08450 (PE794_08450) | 1800840..1801130 | - | 291 | WP_005598848.1 | DUF5389 family protein | - |
| PE794_RS08455 (PE794_08455) | 1801132..1802025 | - | 894 | WP_005598850.1 | site-specific tyrosine recombinase XerD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 156 a.a. Molecular weight: 17206.22 Da Isoelectric Point: 8.9312
>T267561 WP_005598840.1 NZ_CP115971:c1797579-1797112 [Actinobacillus pleuropneumoniae]
MHAPELLSEQHIVRYFQCGEVVLDQWLQRTALKNQQNNASKTFVVCDENKQVMGFYCLSAGSVSHQFVAGALRRNMPDPI
PVIILGRLAVDCSAQGKQLGVSMLKDAVLKSKTVANQIGIKALLVHALNPQAKQFYLKYGFSCSPIDEMVLMLKL
MHAPELLSEQHIVRYFQCGEVVLDQWLQRTALKNQQNNASKTFVVCDENKQVMGFYCLSAGSVSHQFVAGALRRNMPDPI
PVIILGRLAVDCSAQGKQLGVSMLKDAVLKSKTVANQIGIKALLVHALNPQAKQFYLKYGFSCSPIDEMVLMLKL
Download Length: 468 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|