Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | toxTA/Tad-couple_hipB |
Location | 1588779..1589424 | Replicon | chromosome |
Accession | NZ_CP115971 | ||
Organism | Actinobacillus pleuropneumoniae strain HBS1 |
Toxin (Protein)
Gene name | toxT | Uniprot ID | B0BQU7 |
Locus tag | PE794_RS07415 | Protein ID | WP_005619674.1 |
Coordinates | 1589053..1589424 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | toxA | Uniprot ID | - |
Locus tag | PE794_RS07410 | Protein ID | WP_005598477.1 |
Coordinates | 1588779..1589072 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PE794_RS07380 (PE794_07380) | 1584120..1584803 | - | 684 | WP_005598468.1 | arginine ABC transporter permease ArtM | - |
PE794_RS07385 (PE794_07385) | 1584803..1585474 | - | 672 | WP_005598470.1 | arginine ABC transporter permease ArtQ | - |
PE794_RS07390 (PE794_07390) | 1585480..1586199 | - | 720 | WP_043991873.1 | transporter substrate-binding domain-containing protein | - |
PE794_RS07395 (PE794_07395) | 1586219..1586953 | - | 735 | WP_005598473.1 | arginine ABC transporter ATP-binding protein ArtP | - |
PE794_RS07400 (PE794_07400) | 1587178..1587675 | - | 498 | WP_005598474.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
PE794_RS07405 (PE794_07405) | 1587748..1588701 | + | 954 | WP_043991874.1 | calcium/sodium antiporter | - |
PE794_RS07410 (PE794_07410) | 1588779..1589072 | - | 294 | WP_005598477.1 | helix-turn-helix domain-containing protein | Antitoxin |
PE794_RS07415 (PE794_07415) | 1589053..1589424 | - | 372 | WP_005619674.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PE794_RS07420 (PE794_07420) | 1589618..1591369 | + | 1752 | WP_005598482.1 | protein-disulfide reductase DsbD | - |
PE794_RS07425 (PE794_07425) | 1591427..1591996 | + | 570 | WP_005598484.1 | elongation factor P hydroxylase | - |
PE794_RS07430 (PE794_07430) | 1592040..1592894 | - | 855 | WP_005598486.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 15066.57 Da Isoelectric Point: 10.4054
>T267560 WP_005619674.1 NZ_CP115971:c1589424-1589053 [Actinobacillus pleuropneumoniae]
MYEIVFYRDKRGREPVKEFLLRLLKERQEGSRERLHKISHHLSILHLHGTRAGENYIKHLEDRIWQLRPVGDCLLFASII
RGKFVLLHYFAKQNYRIPKREIERAKVRLADLQERIKDEPYWF
MYEIVFYRDKRGREPVKEFLLRLLKERQEGSRERLHKISHHLSILHLHGTRAGENYIKHLEDRIWQLRPVGDCLLFASII
RGKFVLLHYFAKQNYRIPKREIERAKVRLADLQERIKDEPYWF
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|