Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YoeB-YefM |
Location | 1502684..1503192 | Replicon | chromosome |
Accession | NZ_CP115971 | ||
Organism | Actinobacillus pleuropneumoniae strain HBS1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | B0BQK9 |
Locus tag | PE794_RS06955 | Protein ID | WP_005605064.1 |
Coordinates | 1502932..1503192 (+) | Length | 87 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | B0BQK8 |
Locus tag | PE794_RS06950 | Protein ID | WP_005598318.1 |
Coordinates | 1502684..1502935 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PE794_RS06910 (PE794_06910) | 1498221..1498769 | - | 549 | WP_005598298.1 | type IV pilus biogenesis/stability protein PilW | - |
PE794_RS06915 (PE794_06915) | 1498823..1500004 | - | 1182 | WP_005598300.1 | bifunctional tRNA (adenosine(37)-C2)-methyltransferase TrmG/ribosomal RNA large subunit methyltransferase RlmN | - |
PE794_RS06940 (PE794_06940) | 1500908..1502347 | + | 1440 | WP_005598316.1 | glutamate--tRNA ligase | - |
PE794_RS06950 (PE794_06950) | 1502684..1502935 | + | 252 | WP_005598318.1 | YoeB-YefM toxin-antitoxin system antitoxin YefM | Antitoxin |
PE794_RS06955 (PE794_06955) | 1502932..1503192 | + | 261 | WP_005605064.1 | Txe/YoeB family addiction module toxin | Toxin |
PE794_RS06960 (PE794_06960) | 1503351..1503518 | - | 168 | WP_005598320.1 | Trm112 family protein | - |
PE794_RS06965 (PE794_06965) | 1503520..1504500 | - | 981 | WP_005598322.1 | tetraacyldisaccharide 4'-kinase | - |
PE794_RS06970 (PE794_06970) | 1504594..1505853 | - | 1260 | WP_005598324.1 | ATP-dependent protease ATP-binding subunit ClpX | - |
PE794_RS06975 (PE794_06975) | 1505853..1506443 | - | 591 | WP_005598326.1 | ATP-dependent Clp endopeptidase proteolytic subunit ClpP | - |
PE794_RS06980 (PE794_06980) | 1506565..1506957 | + | 393 | WP_005620423.1 | SufE family protein | - |
PE794_RS06995 (PE794_06995) | 1507316..1508089 | - | 774 | WP_005598329.1 | DNA polymerase III subunit epsilon | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 10423.99 Da Isoelectric Point: 8.0109
>T267559 WP_005605064.1 NZ_CP115971:1502932-1503192 [Actinobacillus pleuropneumoniae]
MKLTFSSNAWEDYLYWQKTDKIILKRINSLIKDIQRQPFEGIGKLEPLKFNLSGFWSRRINEEHRLIYSVEDEAILIVAC
RYHYDQ
MKLTFSSNAWEDYLYWQKTDKIILKRINSLIKDIQRQPFEGIGKLEPLKFNLSGFWSRRINEEHRLIYSVEDEAILIVAC
RYHYDQ
Download Length: 261 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|