Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pasABC/RelE-HTH
Location 33333..33807 Replicon plasmid pBM-Y
Accession NZ_CP115970
Organism Wohlfahrtiimonas chitiniclastica strain BM-Y

Toxin (Protein)


Gene name pasB Uniprot ID A0A162TG97
Locus tag PE074_RS10055 Protein ID WP_063455846.1
Coordinates 33333..33599 (-) Length 89 a.a.

Antitoxin (Protein)


Gene name pasA Uniprot ID A0A162TGT6
Locus tag PE074_RS10060 Protein ID WP_063455845.1
Coordinates 33583..33807 (-) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PE074_RS10035 (PE074_10035) 29341..30519 - 1179 WP_063455848.1 replication initiation protein RepM -
PE074_RS10040 (PE074_10040) 31564..31830 - 267 WP_039950103.1 type II toxin-antitoxin system RelE/ParE family toxin -
PE074_RS10045 (PE074_10045) 31814..32038 - 225 WP_039950115.1 DUF6290 family protein -
PE074_RS10050 (PE074_10050) 32505..33191 - 687 WP_063455847.1 IS6 family transposase -
PE074_RS10055 (PE074_10055) 33333..33599 - 267 WP_063455846.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PE074_RS10060 (PE074_10060) 33583..33807 - 225 WP_063455845.1 TraY domain-containing protein Antitoxin
PE074_RS10065 (PE074_10065) 34186..35217 + 1032 WP_063455872.1 replication initiator protein A -
PE074_RS10070 (PE074_10070) 35240..35662 + 423 WP_063455844.1 ACT domain-containing protein -
PE074_RS10075 (PE074_10075) 36041..37243 - 1203 WP_006248867.1 tetracycline efflux MFS transporter Tet(H) -
PE074_RS10080 (PE074_10080) 37335..37958 + 624 WP_006248868.1 tetracycline resistance transcriptional repressor TetR(H) -
PE074_RS10085 (PE074_10085) 37961..38374 - 414 Protein_43 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aac(6')-Ia / ant(2'')-Ia / blaVEB-1 / tet(H) - 1..42382 42382


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-87)

Antitoxin

Relaxosome protein TraY

(4-46)


Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10244.95 Da        Isoelectric Point: 8.8464

>T267558 WP_063455846.1 NZ_CP115970:c33599-33333 [Wohlfahrtiimonas chitiniclastica]
MAWTINYSDTALKSLKKMDKQNAKRIFDTLEGRIVLLDDPRVLGKPLKGNLGELWRYRIGDYRVLCDIQDDQLIILAALI
GYRKEVYD

Download         Length: 267 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8315.32 Da        Isoelectric Point: 4.3785

>AT267558 WP_063455845.1 NZ_CP115970:c33807-33583 [Wohlfahrtiimonas chitiniclastica]
MLAIRLPDDIEARLTALADQTGRTKTYYAREAILAHLDDLEDYYLANQVLTDIRKGTEPVHSSNDVRLALGLDD

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A162TG97

Antitoxin

Source ID Structure
AlphaFold DB A0A162TGT6

References