Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-pasA/RelE-HTH |
Location | 31564..32038 | Replicon | plasmid pBM-Y |
Accession | NZ_CP115970 | ||
Organism | Wohlfahrtiimonas chitiniclastica strain BM-Y |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A165HHB3 |
Locus tag | PE074_RS10040 | Protein ID | WP_039950103.1 |
Coordinates | 31564..31830 (-) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | pasA | Uniprot ID | A0A165HH62 |
Locus tag | PE074_RS10045 | Protein ID | WP_039950115.1 |
Coordinates | 31814..32038 (-) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PE074_RS10030 (PE074_10030) | 27372..28955 | - | 1584 | WP_063455849.1 | type I restriction-modification system subunit M | - |
PE074_RS10035 (PE074_10035) | 29341..30519 | - | 1179 | WP_063455848.1 | replication initiation protein RepM | - |
PE074_RS10040 (PE074_10040) | 31564..31830 | - | 267 | WP_039950103.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PE074_RS10045 (PE074_10045) | 31814..32038 | - | 225 | WP_039950115.1 | DUF6290 family protein | Antitoxin |
PE074_RS10050 (PE074_10050) | 32505..33191 | - | 687 | WP_063455847.1 | IS6 family transposase | - |
PE074_RS10055 (PE074_10055) | 33333..33599 | - | 267 | WP_063455846.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
PE074_RS10060 (PE074_10060) | 33583..33807 | - | 225 | WP_063455845.1 | TraY domain-containing protein | - |
PE074_RS10065 (PE074_10065) | 34186..35217 | + | 1032 | WP_063455872.1 | replication initiator protein A | - |
PE074_RS10070 (PE074_10070) | 35240..35662 | + | 423 | WP_063455844.1 | ACT domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | aac(6')-Ia / ant(2'')-Ia / blaVEB-1 / tet(H) | - | 1..42382 | 42382 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10045.66 Da Isoelectric Point: 7.9891
>T267557 WP_039950103.1 NZ_CP115970:c31830-31564 [Wohlfahrtiimonas chitiniclastica]
MAWTINYSDTALKALKKMDKQNAIRIVDTLEQRIAVLDDPRVSGKALKGNLGDLWRYRIGDYRVLCDIQDGELIILAALI
GHRKDIYD
MAWTINYSDTALKALKKMDKQNAIRIVDTLEQRIAVLDDPRVSGKALKGNLGDLWRYRIGDYRVLCDIQDGELIILAALI
GHRKDIYD
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A165HHB3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A165HH62 |