Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yoeB-relB/YoeB-RelB
Location 7737..8250 Replicon plasmid pBM-Y
Accession NZ_CP115970
Organism Wohlfahrtiimonas chitiniclastica strain BM-Y

Toxin (Protein)


Gene name yoeB Uniprot ID L8XWH7
Locus tag PE074_RS09920 Protein ID WP_008317021.1
Coordinates 7987..8250 (+) Length 88 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID L8XWN0
Locus tag PE074_RS09915 Protein ID WP_008317022.1
Coordinates 7737..7994 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PE074_RS09885 (PE074_09885) 3811..3975 - 165 WP_213404341.1 hypothetical protein -
PE074_RS09890 (PE074_09890) 4005..4865 - 861 WP_008316966.1 hypothetical protein -
PE074_RS09895 (PE074_09895) 5103..5790 + 688 WP_141133759.1 IS6 family transposase -
PE074_RS09900 (PE074_09900) 5830..6432 - 603 Protein_6 IS6 family transposase -
PE074_RS09905 (PE074_09905) 6636..6827 - 192 WP_063455864.1 hypothetical protein -
PE074_RS09910 (PE074_09910) 6889..7524 - 636 WP_063455865.1 ParA family partition ATPase -
PE074_RS09915 (PE074_09915) 7737..7994 + 258 WP_008317022.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
PE074_RS09920 (PE074_09920) 7987..8250 + 264 WP_008317021.1 Txe/YoeB family addiction module toxin Toxin
PE074_RS09925 (PE074_09925) 8332..8631 + 300 WP_008317020.1 hypothetical protein -
PE074_RS09930 (PE074_09930) 8848..9039 - 192 WP_063455864.1 hypothetical protein -
PE074_RS09935 (PE074_09935) 9101..9736 - 636 WP_063455863.1 ParA family partition ATPase -
PE074_RS09940 (PE074_09940) 9825..10427 - 603 WP_008316971.1 recombinase family protein -
PE074_RS09945 (PE074_09945) 10569..11084 - 516 WP_063455862.1 hypothetical protein -
PE074_RS09950 (PE074_09950) 11085..11354 - 270 WP_063455861.1 DUF1778 domain-containing protein -
PE074_RS09955 (PE074_09955) 11547..12023 - 477 WP_252866463.1 IS3 family transposase -
PE074_RS09960 (PE074_09960) 12044..12310 - 267 WP_063455858.1 transposase -
PE074_RS09965 (PE074_09965) 12466..12891 - 426 WP_013136948.1 DUF3788 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aac(6')-Ia / ant(2'')-Ia / blaVEB-1 / tet(H) - 1..42382 42382


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(8-87)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-73)


Sequences

Toxin        


Download         Length: 88 a.a.        Molecular weight: 10581.01 Da        Isoelectric Point: 9.0517

>T267556 WP_008317021.1 NZ_CP115970:7987-8250 [Wohlfahrtiimonas chitiniclastica]
MNSRNIEWTSNSWDEYIYWQTQDKKILKRINSLIKECQRTPFEGTGKPEPLKANLSGFWSRRIDEKHRLVYEVTDEKISI
VQCRFHY

Download         Length: 264 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9609.74 Da        Isoelectric Point: 4.7440

>AT267556 WP_008317022.1 NZ_CP115970:7737-7994 [Wohlfahrtiimonas chitiniclastica]
MHVFTYTDARNNLKSVLDKVVDDADVAFITRKEGGHAVVMGQDHYNSLMETLYLLSSPNNTNRLNESIAQLRSGQVTIRE
LIEDE

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB L8XWH7

Antitoxin

Source ID Structure
AlphaFold DB L8XWN0

References