Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yoeB-relB/YoeB-RelB |
| Location | 7737..8250 | Replicon | plasmid pBM-Y |
| Accession | NZ_CP115970 | ||
| Organism | Wohlfahrtiimonas chitiniclastica strain BM-Y | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | L8XWH7 |
| Locus tag | PE074_RS09920 | Protein ID | WP_008317021.1 |
| Coordinates | 7987..8250 (+) | Length | 88 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | L8XWN0 |
| Locus tag | PE074_RS09915 | Protein ID | WP_008317022.1 |
| Coordinates | 7737..7994 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PE074_RS09885 (PE074_09885) | 3811..3975 | - | 165 | WP_213404341.1 | hypothetical protein | - |
| PE074_RS09890 (PE074_09890) | 4005..4865 | - | 861 | WP_008316966.1 | hypothetical protein | - |
| PE074_RS09895 (PE074_09895) | 5103..5790 | + | 688 | WP_141133759.1 | IS6 family transposase | - |
| PE074_RS09900 (PE074_09900) | 5830..6432 | - | 603 | Protein_6 | IS6 family transposase | - |
| PE074_RS09905 (PE074_09905) | 6636..6827 | - | 192 | WP_063455864.1 | hypothetical protein | - |
| PE074_RS09910 (PE074_09910) | 6889..7524 | - | 636 | WP_063455865.1 | ParA family partition ATPase | - |
| PE074_RS09915 (PE074_09915) | 7737..7994 | + | 258 | WP_008317022.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| PE074_RS09920 (PE074_09920) | 7987..8250 | + | 264 | WP_008317021.1 | Txe/YoeB family addiction module toxin | Toxin |
| PE074_RS09925 (PE074_09925) | 8332..8631 | + | 300 | WP_008317020.1 | hypothetical protein | - |
| PE074_RS09930 (PE074_09930) | 8848..9039 | - | 192 | WP_063455864.1 | hypothetical protein | - |
| PE074_RS09935 (PE074_09935) | 9101..9736 | - | 636 | WP_063455863.1 | ParA family partition ATPase | - |
| PE074_RS09940 (PE074_09940) | 9825..10427 | - | 603 | WP_008316971.1 | recombinase family protein | - |
| PE074_RS09945 (PE074_09945) | 10569..11084 | - | 516 | WP_063455862.1 | hypothetical protein | - |
| PE074_RS09950 (PE074_09950) | 11085..11354 | - | 270 | WP_063455861.1 | DUF1778 domain-containing protein | - |
| PE074_RS09955 (PE074_09955) | 11547..12023 | - | 477 | WP_252866463.1 | IS3 family transposase | - |
| PE074_RS09960 (PE074_09960) | 12044..12310 | - | 267 | WP_063455858.1 | transposase | - |
| PE074_RS09965 (PE074_09965) | 12466..12891 | - | 426 | WP_013136948.1 | DUF3788 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aac(6')-Ia / ant(2'')-Ia / blaVEB-1 / tet(H) | - | 1..42382 | 42382 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10581.01 Da Isoelectric Point: 9.0517
>T267556 WP_008317021.1 NZ_CP115970:7987-8250 [Wohlfahrtiimonas chitiniclastica]
MNSRNIEWTSNSWDEYIYWQTQDKKILKRINSLIKECQRTPFEGTGKPEPLKANLSGFWSRRIDEKHRLVYEVTDEKISI
VQCRFHY
MNSRNIEWTSNSWDEYIYWQTQDKKILKRINSLIKECQRTPFEGTGKPEPLKANLSGFWSRRIDEKHRLVYEVTDEKISI
VQCRFHY
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|