Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1306531..1307155 | Replicon | chromosome |
| Accession | NZ_CP115969 | ||
| Organism | Wohlfahrtiimonas chitiniclastica strain BM-Y | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | PE074_RS06485 | Protein ID | WP_063454832.1 |
| Coordinates | 1306976..1307155 (-) | Length | 60 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A162TIB0 |
| Locus tag | PE074_RS06480 | Protein ID | WP_063454833.1 |
| Coordinates | 1306531..1306929 (-) | Length | 133 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PE074_RS06445 (PE074_06445) | 1301841..1302916 | + | 1076 | WP_094490909.1 | IS3 family transposase | - |
| PE074_RS06450 (PE074_06450) | 1303379..1304128 | - | 750 | WP_063454836.1 | hypothetical protein | - |
| PE074_RS06465 (PE074_06465) | 1304688..1304861 | + | 174 | WP_186821600.1 | hypothetical protein | - |
| PE074_RS06470 (PE074_06470) | 1304905..1305582 | - | 678 | WP_063454835.1 | hypothetical protein | - |
| PE074_RS06475 (PE074_06475) | 1305737..1306489 | + | 753 | WP_063454834.1 | hypothetical protein | - |
| PE074_RS06480 (PE074_06480) | 1306531..1306929 | - | 399 | WP_063454833.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PE074_RS06485 (PE074_06485) | 1306976..1307155 | - | 180 | WP_063454832.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PE074_RS06490 (PE074_06490) | 1307235..1307624 | + | 390 | WP_252866279.1 | M15 family peptidase | - |
| PE074_RS06495 (PE074_06495) | 1308126..1308425 | - | 300 | WP_063454831.1 | DUF3892 domain-containing protein | - |
| PE074_RS06500 (PE074_06500) | 1308530..1308859 | + | 330 | WP_063454830.1 | hypothetical protein | - |
| PE074_RS06505 (PE074_06505) | 1309062..1309748 | + | 687 | WP_063454829.1 | hypothetical protein | - |
| PE074_RS06510 (PE074_06510) | 1309756..1310871 | + | 1116 | WP_063454828.1 | XRE family transcriptional regulator | - |
| PE074_RS06515 (PE074_06515) | 1310888..1311142 | + | 255 | WP_063454827.1 | hypothetical protein | - |
| PE074_RS06520 (PE074_06520) | 1311203..1311430 | + | 228 | WP_063454826.1 | DUF2644 domain-containing protein | - |
| PE074_RS06525 (PE074_06525) | 1311417..1311671 | + | 255 | WP_063454825.1 | hypothetical protein | - |
| PE074_RS06530 (PE074_06530) | 1311824..1312144 | + | 321 | WP_063454824.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1293616..1314121 | 20505 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6612.76 Da Isoelectric Point: 10.6602
>T267555 WP_063454832.1 NZ_CP115969:c1307155-1306976 [Wohlfahrtiimonas chitiniclastica]
MNSKDLIKMIEEDGWYLVATKGSHNQFKHPTKTGRVTIPHPKKDLPKGTVKSILKQAGL
MNSKDLIKMIEEDGWYLVATKGSHNQFKHPTKTGRVTIPHPKKDLPKGTVKSILKQAGL
Download Length: 180 bp
Antitoxin
Download Length: 133 a.a. Molecular weight: 14859.80 Da Isoelectric Point: 4.6138
>AT267555 WP_063454833.1 NZ_CP115969:c1306929-1306531 [Wohlfahrtiimonas chitiniclastica]
MLFHLVVHKDNNSAYGVTVPALEGCFSAGDTLEEAVANSKEAILFHLEGLLEDGLEPAVLNPTLDELRTNPDYQDGFLVS
VDIDISQYTLKPERFNVSWSKNILRQVDMYVAKTHDNRSNFLAKAAIEYMRK
MLFHLVVHKDNNSAYGVTVPALEGCFSAGDTLEEAVANSKEAILFHLEGLLEDGLEPAVLNPTLDELRTNPDYQDGFLVS
VDIDISQYTLKPERFNVSWSKNILRQVDMYVAKTHDNRSNFLAKAAIEYMRK
Download Length: 399 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|