Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/DUF433(antitoxin) |
| Location | 2149640..2150115 | Replicon | chromosome |
| Accession | NZ_CP115960 | ||
| Organism | Sphingomonas sp. 7/4-4 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PIB19_RS10820 | Protein ID | WP_271240821.1 |
| Coordinates | 2149640..2149963 (-) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PIB19_RS10825 | Protein ID | WP_271240822.1 |
| Coordinates | 2149960..2150115 (-) | Length | 52 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB19_RS10795 (PIB19_10795) | 2146071..2146318 | + | 248 | Protein_2134 | hypothetical protein | - |
| PIB19_RS10800 (PIB19_10800) | 2146427..2147377 | + | 951 | WP_271240965.1 | hypothetical protein | - |
| PIB19_RS10805 (PIB19_10805) | 2147313..2148194 | + | 882 | WP_271240818.1 | hypothetical protein | - |
| PIB19_RS10810 (PIB19_10810) | 2148164..2148589 | + | 426 | WP_271240819.1 | ATP-binding cassette domain-containing protein | - |
| PIB19_RS10815 (PIB19_10815) | 2148593..2149615 | + | 1023 | WP_271240820.1 | DUF4238 domain-containing protein | - |
| PIB19_RS10820 (PIB19_10820) | 2149640..2149963 | - | 324 | WP_271240821.1 | DUF5615 family PIN-like protein | Toxin |
| PIB19_RS10825 (PIB19_10825) | 2149960..2150115 | - | 156 | WP_271240822.1 | DUF433 domain-containing protein | Antitoxin |
| PIB19_RS10830 (PIB19_10830) | 2150299..2150475 | + | 177 | WP_271240823.1 | stability determinant | - |
| PIB19_RS10835 (PIB19_10835) | 2151981..2152388 | + | 408 | WP_271240966.1 | DUF3597 domain-containing protein | - |
| PIB19_RS10840 (PIB19_10840) | 2152882..2153115 | + | 234 | WP_271240824.1 | hypothetical protein | - |
| PIB19_RS10845 (PIB19_10845) | 2153368..2153580 | + | 213 | WP_077509887.1 | cold-shock protein | - |
| PIB19_RS10850 (PIB19_10850) | 2153653..2153865 | + | 213 | WP_271240825.1 | hypothetical protein | - |
| PIB19_RS10855 (PIB19_10855) | 2153998..2154147 | + | 150 | WP_271240826.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 11984.73 Da Isoelectric Point: 4.4279
>T267554 WP_271240821.1 NZ_CP115960:c2149963-2149640 [Sphingomonas sp. 7/4-4]
MNFLIDAQLPPALCGWLRERGHQAVHVFEIGMVAASDAEIAARAEADGAVLVSKDEDFVTLRLPDRFMFVWLRCGNTTNR
ALAAWLEARWEQVEALLEAGELFVEAR
MNFLIDAQLPPALCGWLRERGHQAVHVFEIGMVAASDAEIAARAEADGAVLVSKDEDFVTLRLPDRFMFVWLRCGNTTNR
ALAAWLEARWEQVEALLEAGELFVEAR
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|