Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-MazE |
Location | 3396188..3396821 | Replicon | chromosome |
Accession | NZ_CP115957 | ||
Organism | Ralstonia pseudosolanacearum strain PSS4 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q8XUX8 |
Locus tag | PG908_RS16200 | Protein ID | WP_011002948.1 |
Coordinates | 3396188..3396601 (-) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q8XUX7 |
Locus tag | PG908_RS16205 | Protein ID | WP_011002949.1 |
Coordinates | 3396588..3396821 (-) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PG908_RS16180 | 3391564..3393306 | + | 1743 | WP_011002944.1 | ABC transporter substrate-binding protein | - |
PG908_RS16185 | 3393468..3394964 | + | 1497 | WP_011002945.1 | glycerol kinase GlpK | - |
PG908_RS16190 | 3395025..3395396 | - | 372 | WP_011002946.1 | hypothetical protein | - |
PG908_RS16195 | 3395587..3396213 | + | 627 | WP_011002947.1 | DUF1415 domain-containing protein | - |
PG908_RS16200 | 3396188..3396601 | - | 414 | WP_011002948.1 | PIN domain-containing protein | Toxin |
PG908_RS16205 | 3396588..3396821 | - | 234 | WP_011002949.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
PG908_RS16210 | 3396878..3398485 | - | 1608 | WP_043876668.1 | glucan biosynthesis protein | - |
PG908_RS16215 | 3398698..3399930 | + | 1233 | WP_011002951.1 | AGE family epimerase/isomerase | - |
PG908_RS16220 | 3399938..3401233 | + | 1296 | WP_011002952.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15101.45 Da Isoelectric Point: 5.5348
>T267553 WP_011002948.1 NZ_CP115957:c3396601-3396188 [Ralstonia pseudosolanacearum]
MPATEAFFDSNVVLYLLSADTAKADAAETLLMTGGVVTVQVLNETTHVMRRKLAMPWHAIETVQEAVRAQCRVEPLTLET
HDLGRRIAERYGLSVYDALIVAAALLAGCNVLYSEDMQHGLVIEQHLRIVNPFPARA
MPATEAFFDSNVVLYLLSADTAKADAAETLLMTGGVVTVQVLNETTHVMRRKLAMPWHAIETVQEAVRAQCRVEPLTLET
HDLGRRIAERYGLSVYDALIVAAALLAGCNVLYSEDMQHGLVIEQHLRIVNPFPARA
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q8XUX8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A223GR76 |