Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/- |
| Location | 1884257..1884846 | Replicon | chromosome |
| Accession | NZ_CP115957 | ||
| Organism | Ralstonia pseudosolanacearum strain PSS4 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | PG908_RS08745 | Protein ID | WP_043876605.1 |
| Coordinates | 1884257..1884511 (+) | Length | 85 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q8XYR1 |
| Locus tag | PG908_RS08750 | Protein ID | WP_011001638.1 |
| Coordinates | 1884508..1884846 (+) | Length | 113 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PG908_RS08725 | 1879497..1879988 | - | 492 | WP_011001641.1 | glycoside hydrolase family protein | - |
| PG908_RS08730 | 1880057..1880713 | - | 657 | WP_011001640.1 | hypothetical protein | - |
| PG908_RS08735 | 1880739..1881050 | - | 312 | WP_043876606.1 | hypothetical protein | - |
| PG908_RS08740 | 1881050..1884205 | - | 3156 | WP_011001639.1 | host specificity protein J | - |
| PG908_RS08745 | 1884257..1884511 | + | 255 | WP_043876605.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PG908_RS08750 | 1884508..1884846 | + | 339 | WP_011001638.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PG908_RS08755 | 1884916..1885518 | - | 603 | WP_011001637.1 | tail assembly protein | - |
| PG908_RS08760 | 1885522..1886232 | - | 711 | WP_011001636.1 | C40 family peptidase | - |
| PG908_RS08765 | 1886234..1886935 | - | 702 | WP_011001635.1 | phage minor tail protein L | - |
| PG908_RS08770 | 1886932..1887528 | - | 597 | WP_011001634.1 | tail fiber assembly protein | - |
| PG908_RS08775 | 1887534..1888211 | - | 678 | WP_011001633.1 | phage tail protein | - |
| PG908_RS08780 | 1888208..1888546 | - | 339 | WP_011001632.1 | phage tail protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1865000..1915132 | 50132 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 9488.05 Da Isoelectric Point: 10.3121
>T267552 WP_043876605.1 NZ_CP115957:1884257-1884511 [Ralstonia pseudosolanacearum]
MKAKHQKTLELIFSRPTPAGVKWTDAVALMRELGAELEEREGSRVAVFLFGQVKVMHRPHPSPDMDKGAVASMRKWFEEN
GVKP
MKAKHQKTLELIFSRPTPAGVKWTDAVALMRELGAELEEREGSRVAVFLFGQVKVMHRPHPSPDMDKGAVASMRKWFEEN
GVKP
Download Length: 255 bp
Antitoxin
Download Length: 113 a.a. Molecular weight: 12007.63 Da Isoelectric Point: 5.1236
>AT267552 WP_011001638.1 NZ_CP115957:1884508-1884846 [Ralstonia pseudosolanacearum]
MINVMNIGGHKAVIAYDPDIEMFRGEFVGLNGGADFYAADVPGLHREGELSLHVFLEECARRGVEPQKHFSGKFMLRVEG
KVHEAATIAAAAQGVSLNQWAAGVLEQAAEAA
MINVMNIGGHKAVIAYDPDIEMFRGEFVGLNGGADFYAADVPGLHREGELSLHVFLEECARRGVEPQKHFSGKFMLRVEG
KVHEAATIAAAAQGVSLNQWAAGVLEQAAEAA
Download Length: 339 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|