Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-Phd |
Location | 910038..910699 | Replicon | chromosome |
Accession | NZ_CP115957 | ||
Organism | Ralstonia pseudosolanacearum strain PSS4 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PG908_RS04455 | Protein ID | WP_013211023.1 |
Coordinates | 910038..910451 (-) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q8Y121 |
Locus tag | PG908_RS04460 | Protein ID | WP_011000825.1 |
Coordinates | 910448..910699 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PG908_RS04430 | 905424..905624 | + | 201 | WP_226951801.1 | hypothetical protein | - |
PG908_RS04435 | 905599..906243 | + | 645 | WP_064477634.1 | DUF6441 family protein | - |
PG908_RS04440 | 906286..906576 | - | 291 | WP_011000820.1 | H-NS family nucleoid-associated regulatory protein | - |
PG908_RS04445 | 906762..908228 | - | 1467 | WP_247548542.1 | YopJ family acetyltransferase | - |
PG908_RS04450 | 908839..909966 | + | 1128 | WP_193032737.1 | DNA cytosine methyltransferase | - |
PG908_RS04455 | 910038..910451 | - | 414 | WP_013211023.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PG908_RS04460 | 910448..910699 | - | 252 | WP_011000825.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PG908_RS04465 | 910779..914879 | + | 4101 | WP_247548543.1 | tape measure protein | - |
PG908_RS04470 | 914885..915280 | + | 396 | WP_011000827.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 865290..924303 | 59013 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15605.94 Da Isoelectric Point: 5.7557
>T267550 WP_013211023.1 NZ_CP115957:c910451-910038 [Ralstonia pseudosolanacearum]
MSYLIDTNVLSELRRKAPDARVVAWMQDRPRQSLYLSVLTLGEIRKGIERLEDAVRRQNLIDWLEVELPNYFLGRLLDID
AHTADRWGRLMSSAGRPLPAIDGLLAATALQHDLTLVTRNTKDFAGLDVQLINPWEA
MSYLIDTNVLSELRRKAPDARVVAWMQDRPRQSLYLSVLTLGEIRKGIERLEDAVRRQNLIDWLEVELPNYFLGRLLDID
AHTADRWGRLMSSAGRPLPAIDGLLAATALQHDLTLVTRNTKDFAGLDVQLINPWEA
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|