Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/COG3657-dnstrm_HI1420 |
| Location | 68805..69415 | Replicon | plasmid pmega |
| Accession | NZ_CP115956 | ||
| Organism | Ralstonia pseudosolanacearum strain RUN2340 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PG907_RS18210 | Protein ID | WP_193029203.1 |
| Coordinates | 69107..69415 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | PG907_RS18205 | Protein ID | WP_016722339.1 |
| Coordinates | 68805..69110 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PG907_RS18185 | 65162..65872 | + | 711 | Protein_57 | IS5 family transposase | - |
| PG907_RS18190 | 65932..66917 | + | 986 | WP_193025998.1 | IS630 family transposase | - |
| PG907_RS18195 | 66922..67083 | + | 162 | WP_193029856.1 | hypothetical protein | - |
| PG907_RS18200 | 67279..68592 | - | 1314 | WP_193029205.1 | MFS family transporter | - |
| PG907_RS18205 | 68805..69110 | - | 306 | WP_016722339.1 | putative addiction module antidote protein | Antitoxin |
| PG907_RS18210 | 69107..69415 | - | 309 | WP_193029203.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PG907_RS18215 | 69491..70690 | - | 1200 | WP_275761100.1 | MFS transporter | - |
| PG907_RS18220 | 70817..71632 | - | 816 | WP_275761101.1 | GntR family transcriptional regulator | - |
| PG907_RS18225 | 71810..72361 | - | 552 | WP_275761102.1 | helix-turn-helix domain-containing protein | - |
| PG907_RS18230 | 72494..73087 | + | 594 | WP_275761103.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | cyaB / flgC / flgG / fliM / fliI / acrB / adeG / cheY / cheB / cheW / motA | 1..1973144 | 1973144 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11783.57 Da Isoelectric Point: 7.1355
>T267548 WP_193029203.1 NZ_CP115956:c69415-69107 [Ralstonia pseudosolanacearum]
MLTIRTTEIFDDWFCSLRDKAAQRRIQVRIDRLQMGNPGDMKAVRDGIRELRIDHGPGYRLYVVQHGVVLIVLLCGGDKS
TQEADIRRAIDLSRRLDVDDME
MLTIRTTEIFDDWFCSLRDKAAQRRIQVRIDRLQMGNPGDMKAVRDGIRELRIDHGPGYRLYVVQHGVVLIVLLCGGDKS
TQEADIRRAIDLSRRLDVDDME
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|