Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-Phd |
| Location | 3541193..3541854 | Replicon | chromosome |
| Accession | NZ_CP115955 | ||
| Organism | Ralstonia pseudosolanacearum strain RUN2340 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PG907_RS16710 | Protein ID | WP_193026209.1 |
| Coordinates | 3541441..3541854 (+) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | D8N5P4 |
| Locus tag | PG907_RS16705 | Protein ID | WP_020749302.1 |
| Coordinates | 3541193..3541444 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PG907_RS16695 | 3536616..3537011 | - | 396 | WP_197366418.1 | hypothetical protein | - |
| PG907_RS16700 | 3537017..3541117 | - | 4101 | WP_275760264.1 | tape measure protein | - |
| PG907_RS16705 | 3541193..3541444 | + | 252 | WP_020749302.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PG907_RS16710 | 3541441..3541854 | + | 414 | WP_193026209.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PG907_RS16715 | 3541999..3543081 | - | 1083 | WP_275760435.1 | DNA cytosine methyltransferase | - |
| PG907_RS16720 | 3543821..3544111 | + | 291 | WP_275760436.1 | H-NS family nucleoid-associated regulatory protein | - |
| PG907_RS16725 | 3544155..3544799 | - | 645 | WP_193035574.1 | DUF6441 family protein | - |
| PG907_RS16730 | 3544774..3544941 | - | 168 | WP_275760438.1 | hypothetical protein | - |
| PG907_RS16735 | 3544992..3545384 | - | 393 | WP_275760439.1 | hypothetical protein | - |
| PG907_RS16740 | 3545393..3546163 | - | 771 | WP_275760440.1 | hypothetical protein | - |
| PG907_RS16745 | 3546296..3546742 | - | 447 | WP_197366474.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3527474..3577240 | 49766 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15742.09 Da Isoelectric Point: 6.2337
>T267547 WP_193026209.1 NZ_CP115955:3541441-3541854 [Ralstonia pseudosolanacearum]
MSYLIDTNVLSELRRKQPDARVLAWMQDRPRQSLYLSVLTLGEIRKGIERLDDAARRQHLIDWLETELPNYFLGRLLDVD
AHTADRWGRLMSSANRPLPAIDGLLAATALQHDLILVTRNTKDFVGLDVPLINPWET
MSYLIDTNVLSELRRKQPDARVLAWMQDRPRQSLYLSVLTLGEIRKGIERLDDAARRQHLIDWLETELPNYFLGRLLDVD
AHTADRWGRLMSSANRPLPAIDGLLAATALQHDLILVTRNTKDFVGLDVPLINPWET
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|