Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-MazE |
| Location | 3360575..3361208 | Replicon | chromosome |
| Accession | NZ_CP115955 | ||
| Organism | Ralstonia pseudosolanacearum strain RUN2340 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PG907_RS15915 | Protein ID | WP_193027353.1 |
| Coordinates | 3360575..3360988 (-) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | D8N529 |
| Locus tag | PG907_RS15920 | Protein ID | WP_020747258.1 |
| Coordinates | 3360975..3361208 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PG907_RS15890 | 3356079..3357656 | + | 1578 | WP_193027360.1 | glycerol-3-phosphate dehydrogenase | - |
| PG907_RS15895 | 3357913..3358035 | + | 123 | Protein_3114 | ABC transporter | - |
| PG907_RS15900 | 3358036..3358263 | + | 228 | Protein_3115 | carbohydrate ABC transporter substrate-binding protein | - |
| PG907_RS15905 | 3358431..3359927 | + | 1497 | WP_193027357.1 | glycerol kinase GlpK | - |
| PG907_RS15910 | 3359971..3360600 | + | 630 | WP_193027355.1 | DUF1415 family protein | - |
| PG907_RS15915 | 3360575..3360988 | - | 414 | WP_193027353.1 | PIN domain-containing protein | Toxin |
| PG907_RS15920 | 3360975..3361208 | - | 234 | WP_020747258.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| PG907_RS15925 | 3361265..3362872 | - | 1608 | WP_193028416.1 | glucan biosynthesis protein | - |
| PG907_RS15930 | 3363094..3364326 | + | 1233 | WP_193027350.1 | AGE family epimerase/isomerase | - |
| PG907_RS15935 | 3364334..3365629 | + | 1296 | WP_193027348.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15091.41 Da Isoelectric Point: 5.5407
>T267546 WP_193027353.1 NZ_CP115955:c3360988-3360575 [Ralstonia pseudosolanacearum]
MPATEAFFDSNVVLYLLSADAAKADTAETLLMTGGVVSVQVLNETTHVMRRKLAMPWHAIETVQEAVRAQCRIEPLTLET
HELGRRLAERYGLSVYDALIVAAALLAGCNVLYSEDMQHGLVVEQHLRIVNPFSARA
MPATEAFFDSNVVLYLLSADAAKADTAETLLMTGGVVSVQVLNETTHVMRRKLAMPWHAIETVQEAVRAQCRIEPLTLET
HELGRRLAERYGLSVYDALIVAAALLAGCNVLYSEDMQHGLVVEQHLRIVNPFSARA
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|