Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
| Location | 2628212..2628756 | Replicon | chromosome |
| Accession | NZ_CP115955 | ||
| Organism | Ralstonia pseudosolanacearum strain RUN2340 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PG907_RS12350 | Protein ID | WP_193027890.1 |
| Coordinates | 2628481..2628756 (+) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | PG907_RS12345 | Protein ID | WP_193027891.1 |
| Coordinates | 2628212..2628481 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PG907_RS12315 | 2623496..2624065 | - | 570 | WP_275760282.1 | LysR substrate-binding domain-containing protein | - |
| PG907_RS12320 | 2624153..2624941 | - | 789 | WP_193027111.1 | IS21-like element ISRso19 family helper ATPase IstB | - |
| PG907_RS12325 | 2624938..2625954 | - | 1017 | WP_193027114.1 | IS21 family transposase | - |
| PG907_RS12330 | 2625995..2626357 | - | 363 | WP_247664447.1 | LysR family transcriptional regulator | - |
| PG907_RS12335 | 2626489..2627268 | + | 780 | WP_193027892.1 | alpha/beta hydrolase | - |
| PG907_RS12340 | 2627459..2628046 | + | 588 | WP_230642671.1 | NAD(P)H-dependent oxidoreductase | - |
| PG907_RS12345 | 2628212..2628481 | + | 270 | WP_193027891.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| PG907_RS12350 | 2628481..2628756 | + | 276 | WP_193027890.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PG907_RS12355 | 2628841..2629826 | + | 986 | WP_193025998.1 | IS630 family transposase | - |
| PG907_RS12360 | 2629900..2630460 | + | 561 | WP_193027889.1 | DUF2726 domain-containing protein | - |
| PG907_RS12365 | 2630438..2631001 | - | 564 | WP_193027888.1 | recombinase family protein | - |
| PG907_RS12375 | 2631225..2632541 | - | 1317 | WP_193027887.1 | serine--tRNA ligase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 2619534..2629826 | 10292 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10630.33 Da Isoelectric Point: 10.1779
>T267545 WP_193027890.1 NZ_CP115955:2628481-2628756 [Ralstonia pseudosolanacearum]
MEVKWTGKAVSDITRLYEFLSQVNKPAAIRVVQSLTGAPKSLVVNPRIGEQLDEFEPREVRRIIVGQYEMRYAIRGSVIY
VLRLWHTREDR
MEVKWTGKAVSDITRLYEFLSQVNKPAAIRVVQSLTGAPKSLVVNPRIGEQLDEFEPREVRRIIVGQYEMRYAIRGSVIY
VLRLWHTREDR
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|