Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-Phd |
| Location | 747187..747848 | Replicon | plasmid pmega |
| Accession | NZ_CP115953 | ||
| Organism | Ralstonia solanacearum CFBP2957 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A399W071 |
| Locus tag | PG903_RS19375 | Protein ID | WP_003278076.1 |
| Coordinates | 747187..747600 (-) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PG903_RS19380 | Protein ID | WP_003278075.1 |
| Coordinates | 747597..747848 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PG903_RS19335 | 742245..742637 | + | 393 | WP_275719466.1 | hypothetical protein | - |
| PG903_RS19340 | 742634..742855 | + | 222 | WP_275719467.1 | hypothetical protein | - |
| PG903_RS19345 | 742830..743474 | + | 645 | WP_275719468.1 | DUF6441 family protein | - |
| PG903_RS19350 | 743517..743807 | - | 291 | WP_247590003.1 | H-NS family nucleoid-associated regulatory protein | - |
| PG903_RS19355 | 744255..745138 | + | 884 | Protein_631 | IS5 family transposase | - |
| PG903_RS19360 | 745375..745998 | + | 624 | WP_275719469.1 | hypothetical protein | - |
| PG903_RS19365 | 746237..746728 | + | 492 | Protein_633 | IS5 family transposase | - |
| PG903_RS19370 | 746943..747140 | + | 198 | Protein_634 | DNA cytosine methyltransferase | - |
| PG903_RS19375 | 747187..747600 | - | 414 | WP_003278076.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PG903_RS19380 | 747597..747848 | - | 252 | WP_003278075.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PG903_RS19385 | 747923..752023 | + | 4101 | WP_275719470.1 | tape measure protein | - |
| PG903_RS19390 | 752027..752422 | + | 396 | WP_275719471.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | cheY / cyaB / flgG / fliM / fliI / acrB / adeG / cheY / cheB / cheW / motA | 1..2210741 | 2210741 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15756.12 Da Isoelectric Point: 6.2337
>T267539 WP_003278076.1 NZ_CP115953:c747600-747187 [Ralstonia solanacearum CFBP2957]
MSYLIDTNVLSELRRKQPDARVLAWMQDRPRQSLYLSVLTLGEIRKGIERLDDAARRQHLIDWLETELPNYFLGRLLDID
AHTADRWGRLMSSANRPLPAIDGLLAATALQHDLILVTRNTKDFVGLDVPLINPWET
MSYLIDTNVLSELRRKQPDARVLAWMQDRPRQSLYLSVLTLGEIRKGIERLDDAARRQHLIDWLETELPNYFLGRLLDID
AHTADRWGRLMSSANRPLPAIDGLLAATALQHDLILVTRNTKDFVGLDVPLINPWET
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|