Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 567537..568122 | Replicon | plasmid pmega |
| Accession | NZ_CP115953 | ||
| Organism | Ralstonia solanacearum CFBP2957 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | PG903_RS18610 | Protein ID | WP_081262586.1 |
| Coordinates | 567537..567719 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | D8P328 |
| Locus tag | PG903_RS18615 | Protein ID | WP_013207853.1 |
| Coordinates | 567730..568122 (+) | Length | 131 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PG903_RS18600 | 563269..566463 | + | 3195 | WP_013207850.1 | CusA/CzcA family heavy metal efflux RND transporter | - |
| PG903_RS18605 | 566482..566916 | - | 435 | WP_013207851.1 | HIT family protein | - |
| PG903_RS18610 | 567537..567719 | + | 183 | WP_081262586.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PG903_RS18615 | 567730..568122 | + | 393 | WP_013207853.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PG903_RS18620 | 568404..569336 | - | 933 | WP_013207854.1 | 2-hydroxyacid dehydrogenase | - |
| PG903_RS18625 | 569586..570335 | + | 750 | WP_013207855.1 | glycine zipper 2TM domain-containing protein | - |
| PG903_RS18630 | 570446..572257 | + | 1812 | WP_013207856.1 | methyl-accepting chemotaxis protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | cheY / cyaB / flgG / fliM / fliI / acrB / adeG / cheY / cheB / cheW / motA | 1..2210741 | 2210741 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6581.72 Da Isoelectric Point: 11.5522
>T267538 WP_081262586.1 NZ_CP115953:567537-567719 [Ralstonia solanacearum CFBP2957]
INSANLIKQLRADGWQLVHVVGSNHQFKHPTKPGKVTVPHPKKDLPPGTVRSILKQAGLK
INSANLIKQLRADGWQLVHVVGSNHQFKHPTKPGKVTVPHPKKDLPPGTVRSILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 131 a.a. Molecular weight: 14524.34 Da Isoelectric Point: 4.7514
>AT267538 WP_013207853.1 NZ_CP115953:567730-568122 [Ralstonia solanacearum CFBP2957]
MLYPLYVYVGDAKHAHGVTFPDFPGCHAAADEWEDLPRAVQEAAEAHFAGDDDPIPAPTPLERLTADPEYEGGVWMLFNL
DLSRLRSRTVRINVSVPEGLLSQIDAFAQRRHMTRSAFLALAAQHEMEHV
MLYPLYVYVGDAKHAHGVTFPDFPGCHAAADEWEDLPRAVQEAAEAHFAGDDDPIPAPTPLERLTADPEYEGGVWMLFNL
DLSRLRSRTVRINVSVPEGLLSQIDAFAQRRHMTRSAFLALAAQHEMEHV
Download Length: 393 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|