Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-PumB/COG3657-dnstrm_HI1420 |
| Location | 60586..61205 | Replicon | plasmid pmega |
| Accession | NZ_CP115953 | ||
| Organism | Ralstonia solanacearum CFBP2957 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | D8P722 |
| Locus tag | PG903_RS16460 | Protein ID | WP_013207426.1 |
| Coordinates | 60888..61205 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | PG903_RS16455 | Protein ID | WP_003262836.1 |
| Coordinates | 60586..60891 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PG903_RS16435 | 56536..58155 | + | 1620 | WP_042591747.1 | AMP-binding protein | - |
| PG903_RS16440 | 58152..58562 | + | 411 | WP_013207423.1 | thioesterase family protein | - |
| PG903_RS16445 | 58592..58984 | + | 393 | WP_013207424.1 | RidA family protein | - |
| PG903_RS16450 | 59051..60364 | - | 1314 | WP_013207425.1 | MFS family transporter | - |
| PG903_RS16455 | 60586..60891 | - | 306 | WP_003262836.1 | putative addiction module antidote protein | Antitoxin |
| PG903_RS16460 | 60888..61205 | - | 318 | WP_013207426.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PG903_RS16465 | 61281..62480 | - | 1200 | WP_013207427.1 | MFS transporter | - |
| PG903_RS16470 | 62607..63425 | - | 819 | WP_013207428.1 | GntR family transcriptional regulator | - |
| PG903_RS16475 | 63595..64146 | - | 552 | WP_176462251.1 | helix-turn-helix domain-containing protein | - |
| PG903_RS16480 | 64280..64876 | + | 597 | WP_013207430.1 | GNAT family N-acetyltransferase | - |
| PG903_RS16485 | 65136..65570 | + | 435 | WP_013207431.1 | VOC family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | cheY / cyaB / flgG / fliM / fliI / acrB / adeG / cheY / cheB / cheW / motA | 1..2210741 | 2210741 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12109.86 Da Isoelectric Point: 6.7119
>T267535 WP_013207426.1 NZ_CP115953:c61205-60888 [Ralstonia solanacearum CFBP2957]
MLTIRTTELFDDWFCSLRDKAVQRRIQVRIDRLQMGHPGDMKAVRDGIRELRIDHGPGYRLYFVQHGVVLIVLLCGGAKS
TQEADSRRAIDLSRRLDVDDVDDVE
MLTIRTTELFDDWFCSLRDKAVQRRIQVRIDRLQMGHPGDMKAVRDGIRELRIDHGPGYRLYFVQHGVVLIVLLCGGAKS
TQEADSRRAIDLSRRLDVDDVDDVE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|