Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 1099079..1099668 | Replicon | chromosome |
Accession | NZ_CP115952 | ||
Organism | Ralstonia solanacearum CFBP2957 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | PG903_RS05340 | Protein ID | WP_013206420.1 |
Coordinates | 1099414..1099668 (-) | Length | 85 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | PG903_RS05335 | Protein ID | WP_013206421.1 |
Coordinates | 1099079..1099417 (-) | Length | 113 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PG903_RS05305 | 1095284..1095622 | + | 339 | WP_013206427.1 | phage tail protein | - |
PG903_RS05310 | 1095715..1096296 | + | 582 | WP_275719037.1 | phage tail protein | - |
PG903_RS05315 | 1096302..1096898 | + | 597 | WP_013206425.1 | tail fiber assembly protein | - |
PG903_RS05320 | 1096895..1097596 | + | 702 | WP_013206424.1 | phage minor tail protein L | - |
PG903_RS05325 | 1097598..1098308 | + | 711 | WP_013206423.1 | C40 family peptidase | - |
PG903_RS05330 | 1098312..1098914 | + | 603 | WP_043908480.1 | tail assembly protein | - |
PG903_RS05335 | 1099079..1099417 | - | 339 | WP_013206421.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PG903_RS05340 | 1099414..1099668 | - | 255 | WP_013206420.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PG903_RS05345 | 1099717..1102872 | + | 3156 | WP_013206419.1 | host specificity protein J | - |
PG903_RS05350 | 1103230..1103868 | + | 639 | WP_013206417.1 | hypothetical protein | - |
PG903_RS05355 | 1103937..1104428 | + | 492 | WP_013206416.1 | glycoside hydrolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1070042..1118147 | 48105 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 9442.01 Da Isoelectric Point: 10.2487
>T267534 WP_013206420.1 NZ_CP115952:c1099668-1099414 [Ralstonia solanacearum CFBP2957]
MKAKHQKTLELIFSRPTPASVKWADAVALMKELGAELEEREGSRVAVFLFGQVKVMHRPHPSPDIDKGAVASMRKWFEEN
GVKP
MKAKHQKTLELIFSRPTPASVKWADAVALMKELGAELEEREGSRVAVFLFGQVKVMHRPHPSPDIDKGAVASMRKWFEEN
GVKP
Download Length: 255 bp
Antitoxin
Download Length: 113 a.a. Molecular weight: 12092.73 Da Isoelectric Point: 5.1462
>AT267534 WP_013206421.1 NZ_CP115952:c1099417-1099079 [Ralstonia solanacearum CFBP2957]
MINVMNIGGHKAVIAYDPDIEMFRGEFVGLNGGADFYAADVPGLHREGELSLRVFLDECARRGVEPQKHFSGRFVLRVEG
KVHEAAAIAAAARGVSLNQWAADVLEQAAEVA
MINVMNIGGHKAVIAYDPDIEMFRGEFVGLNGGADFYAADVPGLHREGELSLRVFLDECARRGVEPQKHFSGRFVLRVEG
KVHEAAAIAAAARGVSLNQWAADVLEQAAEVA
Download Length: 339 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|