Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-Phd |
Location | 1788414..1789075 | Replicon | plasmid pmega |
Accession | NZ_CP115947 | ||
Organism | Ralstonia solanacearum MolK2 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A399W071 |
Locus tag | PG909_RS22055 | Protein ID | WP_003278076.1 |
Coordinates | 1788662..1789075 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PG909_RS22050 | Protein ID | WP_003278075.1 |
Coordinates | 1788414..1788665 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PG909_RS22040 | 1783838..1784233 | - | 396 | WP_042550185.1 | hypothetical protein | - |
PG909_RS22045 | 1784239..1788339 | - | 4101 | WP_042550184.1 | tape measure protein | - |
PG909_RS22050 | 1788414..1788665 | + | 252 | WP_003278075.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PG909_RS22055 | 1788662..1789075 | + | 414 | WP_003278076.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PG909_RS22060 | 1789122..1790219 | - | 1098 | WP_049279767.1 | DNA cytosine methyltransferase | - |
PG909_RS22065 | 1790753..1791043 | + | 291 | WP_003278079.1 | H-NS histone family protein | - |
PG909_RS22070 | 1791086..1791730 | - | 645 | WP_003278081.1 | DUF6441 family protein | - |
PG909_RS22075 | 1791705..1791896 | - | 192 | WP_230675536.1 | hypothetical protein | - |
PG909_RS22080 | 1791923..1792315 | - | 393 | WP_003278083.1 | hypothetical protein | - |
PG909_RS22085 | 1792324..1793097 | - | 774 | WP_003278085.1 | hypothetical protein | - |
PG909_RS22090 | 1793209..1793655 | - | 447 | WP_003278086.1 | hypothetical protein | - |
PG909_RS22095 | 1793661..1793963 | - | 303 | WP_003278088.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | cheY / icl | 1..2326525 | 2326525 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15756.12 Da Isoelectric Point: 6.2337
>T267532 WP_003278076.1 NZ_CP115947:1788662-1789075 [Ralstonia solanacearum MolK2]
MSYLIDTNVLSELRRKQPDARVLAWMQDRPRQSLYLSVLTLGEIRKGIERLDDAARRQHLIDWLETELPNYFLGRLLDID
AHTADRWGRLMSSANRPLPAIDGLLAATALQHDLILVTRNTKDFVGLDVPLINPWET
MSYLIDTNVLSELRRKQPDARVLAWMQDRPRQSLYLSVLTLGEIRKGIERLDDAARRQHLIDWLETELPNYFLGRLLDID
AHTADRWGRLMSSANRPLPAIDGLLAATALQHDLILVTRNTKDFVGLDVPLINPWET
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|