Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 812394..812983 | Replicon | plasmid pmega |
Accession | NZ_CP115947 | ||
Organism | Ralstonia solanacearum MolK2 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | PG909_RS17455 | Protein ID | WP_042550676.1 |
Coordinates | 812729..812983 (-) | Length | 85 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | PG909_RS17450 | Protein ID | WP_003276099.1 |
Coordinates | 812394..812732 (-) | Length | 113 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PG909_RS17420 | 808600..808938 | + | 339 | WP_003276092.1 | phage tail protein | - |
PG909_RS17425 | 808935..809612 | + | 678 | WP_003276093.1 | phage tail protein | - |
PG909_RS17430 | 809618..810214 | + | 597 | WP_003276094.1 | tail fiber assembly protein | - |
PG909_RS17435 | 810211..810912 | + | 702 | WP_003276095.1 | phage minor tail protein L | - |
PG909_RS17440 | 810914..811624 | + | 711 | Protein_742 | C40 family peptidase | - |
PG909_RS17445 | 811628..812230 | + | 603 | WP_003276098.1 | tail assembly protein | - |
PG909_RS17450 | 812394..812732 | - | 339 | WP_003276099.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PG909_RS17455 | 812729..812983 | - | 255 | WP_042550676.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PG909_RS17460 | 813033..816188 | + | 3156 | WP_003276100.1 | host specificity protein J | - |
PG909_RS17465 | 816188..816499 | + | 312 | WP_003276101.1 | hypothetical protein | - |
PG909_RS17470 | 816546..817184 | + | 639 | WP_003276102.1 | hypothetical protein | - |
PG909_RS17475 | 817253..817750 | + | 498 | WP_003276103.1 | glycoside hydrolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | cheY / icl | 1..2326525 | 2326525 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 9437.96 Da Isoelectric Point: 10.3121
>T267531 WP_042550676.1 NZ_CP115947:c812983-812729 [Ralstonia solanacearum MolK2]
MRAKHQKTLELIFSRPTPASVKWADAVALMKELGAELEDREGSRVAVFLFGQVKVMHRPHPSPDIDKGAVASIRKWFEEN
GVKP
MRAKHQKTLELIFSRPTPASVKWADAVALMKELGAELEDREGSRVAVFLFGQVKVMHRPHPSPDIDKGAVASIRKWFEEN
GVKP
Download Length: 255 bp
Antitoxin
Download Length: 113 a.a. Molecular weight: 12064.67 Da Isoelectric Point: 4.8675
>AT267531 WP_003276099.1 NZ_CP115947:c812732-812394 [Ralstonia solanacearum MolK2]
MINVMNIGGHKAVIAYDPDIEMFRGEFVGLNGGADFYAADVPGLHREGELSLRVFLDECARRGVEPQKHFSGRFVLRVEG
KVHEAAAIAAAAQGVSLNQWAADVLEQAAEVA
MINVMNIGGHKAVIAYDPDIEMFRGEFVGLNGGADFYAADVPGLHREGELSLRVFLDECARRGVEPQKHFSGRFVLRVEG
KVHEAAAIAAAAQGVSLNQWAADVLEQAAEVA
Download Length: 339 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|