Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-MazE |
Location | 2759853..2760486 | Replicon | chromosome |
Accession | NZ_CP115946 | ||
Organism | Ralstonia solanacearum MolK2 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PG909_RS12110 | Protein ID | WP_042550838.1 |
Coordinates | 2759853..2760266 (-) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | F6FXL0 |
Locus tag | PG909_RS12115 | Protein ID | WP_003263271.1 |
Coordinates | 2760253..2760486 (-) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PG909_RS12090 | 2755191..2756927 | + | 1737 | WP_003273655.1 | ABC transporter substrate-binding protein | - |
PG909_RS12095 | 2757098..2758594 | + | 1497 | WP_003273657.1 | glycerol kinase GlpK | - |
PG909_RS12100 | 2758670..2759041 | - | 372 | WP_003263275.1 | hypothetical protein | - |
PG909_RS12105 | 2759252..2759878 | + | 627 | WP_042550837.1 | DUF1415 family protein | - |
PG909_RS12110 | 2759853..2760266 | - | 414 | WP_042550838.1 | PIN domain-containing protein | Toxin |
PG909_RS12115 | 2760253..2760486 | - | 234 | WP_003263271.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
PG909_RS12120 | 2760544..2762151 | - | 1608 | WP_042550839.1 | glucan biosynthesis protein | - |
PG909_RS12125 | 2762347..2763615 | + | 1269 | WP_155402184.1 | AGE family epimerase/isomerase | - |
PG909_RS12130 | 2763623..2764912 | + | 1290 | WP_003263268.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 14871.19 Da Isoelectric Point: 5.9701
>T267529 WP_042550838.1 NZ_CP115946:c2760266-2759853 [Ralstonia solanacearum MolK2]
MPAAEAFFDSNIVLYLLSADAAKADAAEALLMAGGVVSVQVLNETTHVMRRKLAMPWHAIEAVQEAVRAQCRVEPLTVET
HDLGRHLAQRYGLSVYDALIVAAASLAGCRVLYSEDMQHGLVIEQRLRVVNPFVASA
MPAAEAFFDSNIVLYLLSADAAKADAAEALLMAGGVVSVQVLNETTHVMRRKLAMPWHAIEAVQEAVRAQCRVEPLTVET
HDLGRHLAQRYGLSVYDALIVAAASLAGCRVLYSEDMQHGLVIEQRLRVVNPFVASA
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|