Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
Location | 1432239..1432783 | Replicon | chromosome |
Accession | NZ_CP115946 | ||
Organism | Ralstonia solanacearum MolK2 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | PG909_RS06495 | Protein ID | WP_003276775.1 |
Coordinates | 1432508..1432783 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | PG909_RS06490 | Protein ID | WP_003276774.1 |
Coordinates | 1432239..1432508 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PG909_RS06465 | 1428811..1429689 | - | 879 | WP_003276768.1 | EamA family transporter | - |
PG909_RS06470 | 1430077..1430214 | + | 138 | WP_230680075.1 | hypothetical protein | - |
PG909_RS06475 | 1430348..1430731 | + | 384 | WP_003276772.1 | hypothetical protein | - |
PG909_RS06480 | 1430765..1431661 | - | 897 | WP_042589407.1 | LysR substrate-binding domain-containing protein | - |
PG909_RS06485 | 1431794..1431946 | + | 153 | WP_230680172.1 | hypothetical protein | - |
PG909_RS06490 | 1432239..1432508 | + | 270 | WP_003276774.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
PG909_RS06495 | 1432508..1432783 | + | 276 | WP_003276775.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PG909_RS06500 | 1432897..1433760 | - | 864 | WP_155402169.1 | spermidine synthase | - |
PG909_RS06505 | 1434050..1434985 | + | 936 | WP_064298732.1 | 5-dehydro-4-deoxyglucarate dehydratase | - |
PG909_RS06510 | 1435017..1436603 | + | 1587 | WP_003276780.1 | aldehyde dehydrogenase (NADP(+)) | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10690.42 Da Isoelectric Point: 9.8951
>T267527 WP_003276775.1 NZ_CP115946:1432508-1432783 [Ralstonia solanacearum MolK2]
MELKWTSKALSDVARLYEFLAPVNKPAAARAVQALIKASTILLTNPRVGEQLFQFEPREVRRILVGQYEMRYALQDETIY
VLRLWHTREDR
MELKWTSKALSDVARLYEFLAPVNKPAAARAVQALIKASTILLTNPRVGEQLFQFEPREVRRILVGQYEMRYALQDETIY
VLRLWHTREDR
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|