Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/COG3657-dnstrm_HI1420 |
| Location | 69712..70322 | Replicon | plasmid pmega |
| Accession | NZ_CP115945 | ||
| Organism | Ralstonia syzygii R24 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PG906_RS18085 | Protein ID | WP_197334114.1 |
| Coordinates | 70014..70322 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | PG906_RS18080 | Protein ID | WP_197328656.1 |
| Coordinates | 69712..70017 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PG906_RS18070 | 66974..68119 | + | 1146 | WP_197334116.1 | DUF2220 family protein | - |
| PG906_RS18075 | 68188..69501 | - | 1314 | WP_197334115.1 | MFS family transporter | - |
| PG906_RS18080 | 69712..70017 | - | 306 | WP_197328656.1 | putative addiction module antidote protein | Antitoxin |
| PG906_RS18085 | 70014..70322 | - | 309 | WP_197334114.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PG906_RS18090 | 70407..70997 | - | 591 | WP_197334113.1 | MFS transporter | - |
| PG906_RS18095 | 71125..71940 | - | 816 | WP_075465905.1 | GntR family transcriptional regulator | - |
| PG906_RS18100 | 72114..72611 | - | 498 | WP_197334452.1 | helix-turn-helix domain-containing protein | - |
| PG906_RS18105 | 72800..73396 | + | 597 | WP_197328660.1 | GNAT family N-acetyltransferase | - |
| PG906_RS18110 | 73652..74086 | + | 435 | WP_197328661.1 | VOC family protein | - |
| PG906_RS18115 | 74356..75237 | + | 882 | WP_197328662.1 | LysR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | cheY / cyaB / flgC / flgG / fliM / fliG / fliI / adeG / cheY / cheB / cheW / motA | 1..1751279 | 1751279 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11793.57 Da Isoelectric Point: 8.5237
>T267523 WP_197334114.1 NZ_CP115945:c70322-70014 [Ralstonia syzygii R24]
MLTIRTTEIFDDWFCSLRDKAAQRRVQVRIDRLQMGNPGDVKAVREGIREMRIDHGPGYRVYFAQRGVILIVLLCGGDKS
TQEADVRRAIDLSRRLDVDNME
MLTIRTTEIFDDWFCSLRDKAAQRRVQVRIDRLQMGNPGDVKAVREGIREMRIDHGPGYRVYFAQRGVILIVLLCGGDKS
TQEADVRRAIDLSRRLDVDNME
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|