Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-Phd |
Location | 3453110..3453771 | Replicon | chromosome |
Accession | NZ_CP115944 | ||
Organism | Ralstonia syzygii R24 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PG906_RS16575 | Protein ID | WP_197333267.1 |
Coordinates | 3453358..3453771 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q8Y121 |
Locus tag | PG906_RS16570 | Protein ID | WP_011000825.1 |
Coordinates | 3453110..3453361 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PG906_RS16560 | 3448529..3448924 | - | 396 | WP_197333269.1 | hypothetical protein | - |
PG906_RS16565 | 3448930..3453030 | - | 4101 | WP_197333268.1 | tape measure protein | - |
PG906_RS16570 | 3453110..3453361 | + | 252 | WP_011000825.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PG906_RS16575 | 3453358..3453771 | + | 414 | WP_197333267.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PG906_RS16580 | 3454430..3455086 | + | 657 | WP_269436999.1 | XopAF/AvrXv3 family type III secretion system effector | - |
PG906_RS16585 | 3455209..3455853 | - | 645 | WP_197333265.1 | DUF6441 family protein | - |
PG906_RS16590 | 3455828..3456049 | - | 222 | WP_197333264.1 | hypothetical protein | - |
PG906_RS16595 | 3456046..3456435 | - | 390 | WP_197333263.1 | hypothetical protein | - |
PG906_RS16600 | 3456444..3457217 | - | 774 | WP_197333262.1 | hypothetical protein | - |
PG906_RS16605 | 3457340..3457786 | - | 447 | WP_197333261.1 | hypothetical protein | - |
PG906_RS16610 | 3457792..3458094 | - | 303 | WP_197333260.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3425083..3488330 | 63247 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15603.96 Da Isoelectric Point: 5.7498
>T267522 WP_197333267.1 NZ_CP115944:3453358-3453771 [Ralstonia syzygii R24]
MSYLIDTNVLSELRRKAPDARVVAWMQDRPRQSLYLSVLTLGEIRKGIERLDDAVRRQNLIDWLEVELPNYFLGRLLDID
AHTADRWGRLMSSAGRPLPAIDGLLAATALQHDLTLVTRNIKDFAGLDVQLINPWEA
MSYLIDTNVLSELRRKAPDARVVAWMQDRPRQSLYLSVLTLGEIRKGIERLDDAVRRQNLIDWLEVELPNYFLGRLLDID
AHTADRWGRLMSSAGRPLPAIDGLLAATALQHDLTLVTRNIKDFAGLDVQLINPWEA
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|