Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
Location | 2975824..2976377 | Replicon | chromosome |
Accession | NZ_CP115944 | ||
Organism | Ralstonia syzygii R24 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | PG906_RS14355 | Protein ID | WP_197333438.1 |
Coordinates | 2975824..2976117 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | G3A1N4 |
Locus tag | PG906_RS14360 | Protein ID | WP_071089703.1 |
Coordinates | 2976105..2976377 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PG906_RS14325 | 2971568..2972980 | + | 1413 | WP_197333440.1 | hypothetical protein | - |
PG906_RS14330 | 2973065..2973568 | + | 504 | WP_197333439.1 | hypothetical protein | - |
PG906_RS14335 | 2973629..2974666 | - | 1038 | WP_197334913.1 | IS481 family transposase | - |
PG906_RS14340 | 2974835..2975089 | - | 255 | WP_143012699.1 | hypothetical protein | - |
PG906_RS14345 | 2975157..2975507 | - | 351 | WP_231649637.1 | hypothetical protein | - |
PG906_RS14350 | 2975504..2975821 | - | 318 | WP_275793981.1 | hypothetical protein | - |
PG906_RS14355 | 2975824..2976117 | - | 294 | WP_197333438.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PG906_RS14360 | 2976105..2976377 | - | 273 | WP_071089703.1 | CopG family ribbon-helix-helix protein | Antitoxin |
PG906_RS14365 | 2976507..2976806 | - | 300 | WP_197333437.1 | hypothetical protein | - |
PG906_RS14370 | 2976919..2978592 | - | 1674 | WP_275793984.1 | relaxase/mobilization nuclease domain-containing protein | - |
PG906_RS14375 | 2978589..2978897 | - | 309 | WP_247570175.1 | MobB mobilization protein | - |
PG906_RS14380 | 2979196..2979483 | + | 288 | WP_197333434.1 | hypothetical protein | - |
PG906_RS14385 | 2979573..2979989 | + | 417 | WP_197333433.1 | hypothetical protein | - |
PG906_RS14390 | 2980297..2980914 | + | 618 | WP_197333432.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2973629..2984746 | 11117 | |
- | flank | IS/Tn | - | - | 2973629..2974666 | 1037 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10866.32 Da Isoelectric Point: 7.2770
>T267521 WP_197333438.1 NZ_CP115944:c2976117-2975824 [Ralstonia syzygii R24]
VPRVIITEGAAQGLERCRRFLAGKSPEATRRAGQTIARHLATLETTPTIGRPFAELPEWRELVIEFGDSGYVALYRHEPA
DDAVYVLAFRHQKEAGY
VPRVIITEGAAQGLERCRRFLAGKSPEATRRAGQTIARHLATLETTPTIGRPFAELPEWRELVIEFGDSGYVALYRHEPA
DDAVYVLAFRHQKEAGY
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|