Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 1450681..1451378 | Replicon | chromosome |
Accession | NZ_CP115944 | ||
Organism | Ralstonia syzygii R24 |
Toxin (Protein)
Gene name | tad | Uniprot ID | - |
Locus tag | PG906_RS07145 | Protein ID | WP_197334584.1 |
Coordinates | 1450681..1451034 (+) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | - |
Locus tag | PG906_RS07150 | Protein ID | WP_197334585.1 |
Coordinates | 1451037..1451378 (+) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PG906_RS07120 | 1447214..1447435 | + | 222 | WP_197334579.1 | hypothetical protein | - |
PG906_RS07125 | 1447532..1447825 | - | 294 | WP_197334580.1 | hypothetical protein | - |
PG906_RS07130 | 1447892..1449208 | + | 1317 | WP_197334581.1 | hypothetical protein | - |
PG906_RS07135 | 1449205..1449780 | + | 576 | WP_275794652.1 | hypothetical protein | - |
PG906_RS07140 | 1450068..1450622 | + | 555 | WP_197334583.1 | tyrosine-type recombinase/integrase | - |
PG906_RS07145 | 1450681..1451034 | + | 354 | WP_197334584.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PG906_RS07150 | 1451037..1451378 | + | 342 | WP_197334585.1 | helix-turn-helix transcriptional regulator | Antitoxin |
PG906_RS07155 | 1451385..1452041 | + | 657 | WP_197334586.1 | hypothetical protein | - |
PG906_RS07160 | 1452074..1453039 | - | 966 | WP_197334587.1 | hypothetical protein | - |
PG906_RS07165 | 1453181..1453774 | + | 594 | WP_197334588.1 | 2OG-Fe(II) oxygenase | - |
PG906_RS07170 | 1453848..1454039 | - | 192 | WP_197334589.1 | hypothetical protein | - |
PG906_RS07175 | 1454053..1456296 | - | 2244 | WP_197334590.1 | YcaO-like family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1440416..1457453 | 17037 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 12916.93 Da Isoelectric Point: 9.6256
>T267520 WP_197334584.1 NZ_CP115944:1450681-1451034 [Ralstonia syzygii R24]
MPMIRPLRWVGSAKKDLSVMPDDVQDTFGYALHLAQVGGKHSQAKPLKGYGGAGVLEVVEDHQGNTYRAVYTVRYAGAVY
VLHCFQKKSTHGIATPRPDLDLIEARLKAVIALEKER
MPMIRPLRWVGSAKKDLSVMPDDVQDTFGYALHLAQVGGKHSQAKPLKGYGGAGVLEVVEDHQGNTYRAVYTVRYAGAVY
VLHCFQKKSTHGIATPRPDLDLIEARLKAVIALEKER
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|