Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/COG3657-dnstrm_HI1420 |
Location | 66437..67047 | Replicon | plasmid pmega |
Accession | NZ_CP115942 | ||
Organism | Ralstonia syzygii strain BDBR229 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | PG904_RS17050 | Protein ID | WP_078223783.1 |
Coordinates | 66739..67047 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | PG904_RS17045 | Protein ID | WP_013209163.1 |
Coordinates | 66437..66742 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PG904_RS17020 | 61619..62941 | + | 1323 | WP_078221935.1 | IS5 family transposase | - |
PG904_RS17025 | 63168..63452 | - | 285 | WP_078223782.1 | hypothetical protein | - |
PG904_RS17030 | 63786..63973 | + | 188 | Protein_54 | transposase | - |
PG904_RS17035 | 64113..64808 | + | 696 | WP_237331745.1 | hypothetical protein | - |
PG904_RS17040 | 64913..66226 | - | 1314 | WP_013209162.1 | MFS family transporter | - |
PG904_RS17045 | 66437..66742 | - | 306 | WP_013209163.1 | putative addiction module antidote protein | Antitoxin |
PG904_RS17050 | 66739..67047 | - | 309 | WP_078223783.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PG904_RS17055 | 67132..68331 | - | 1200 | WP_013209165.1 | MFS transporter | - |
PG904_RS17060 | 68459..69274 | - | 816 | WP_013209166.1 | GntR family transcriptional regulator | - |
PG904_RS17065 | 69448..69999 | - | 552 | WP_078223784.1 | helix-turn-helix domain-containing protein | - |
PG904_RS17070 | 70181..70726 | + | 546 | WP_275760125.1 | GNAT family N-acetyltransferase | - |
PG904_RS17075 | 70983..71417 | + | 435 | WP_013209169.1 | VOC family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | cheY / cheY / cheB / cheW / motA / katA / acrB | 1..1578131 | 1578131 | |
- | flank | IS/Tn | - | - | 61619..62941 | 1322 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11821.56 Da Isoelectric Point: 9.0017
>T267518 WP_078223783.1 NZ_CP115942:c67047-66739 [Ralstonia syzygii]
MLTIRTTEIFDDWFYSLRDKAAQRRVQVRIDRLQMGNPGDVKTVREGIREMRIDHGPGYRVYVAQRGVVLIVLLCGGDKS
TQEADVRRAIDLSRRLDVDNME
MLTIRTTEIFDDWFYSLRDKAAQRRVQVRIDRLQMGNPGDVKTVREGIREMRIDHGPGYRVYVAQRGVVLIVLLCGGDKS
TQEADVRRAIDLSRRLDVDNME
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|