Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 126809..127545 Replicon plasmid pKpUC43_162k
Accession NZ_CP115933
Organism Klebsiella pneumoniae subsp. pneumoniae strain 43UC01

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag DLD89_RS27770 Protein ID WP_003026803.1
Coordinates 126809..127291 (-) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag DLD89_RS27775 Protein ID WP_003026799.1
Coordinates 127279..127545 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DLD89_RS27745 (DLD89_27740) 121971..122459 + 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -
DLD89_RS27750 (DLD89_27745) 122446..123408 + 963 WP_004152113.1 zinc metalloprotease HtpX -
DLD89_RS27755 (DLD89_27750) 123585..124750 + 1166 Protein_134 IS3 family transposase -
DLD89_RS27760 (DLD89_27755) 124959..125090 - 132 WP_004218042.1 hypothetical protein -
DLD89_RS27765 (DLD89_27760) 125251..126597 - 1347 WP_020314316.1 ISNCY family transposase -
DLD89_RS27770 (DLD89_27765) 126809..127291 - 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
DLD89_RS27775 (DLD89_27770) 127279..127545 - 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
DLD89_RS27780 (DLD89_27775) 127721..127975 - 255 WP_004152108.1 hypothetical protein -
DLD89_RS27785 (DLD89_27780) 128051..128308 - 258 WP_004152107.1 hypothetical protein -
DLD89_RS27790 (DLD89_27785) 128357..128560 - 204 WP_004152106.1 HHA domain-containing protein -
DLD89_RS27795 (DLD89_27790) 128594..128962 - 369 WP_004152105.1 hypothetical protein -
DLD89_RS27800 (DLD89_27795) 129006..129500 - 495 WP_004152104.1 DNA-binding protein -
DLD89_RS27805 (DLD89_27800) 129531..130106 - 576 WP_004152103.1 hypothetical protein -
DLD89_RS27810 (DLD89_27805) 130094..130363 - 270 WP_004152102.1 hypothetical protein -
DLD89_RS27815 (DLD89_27810) 130933..131283 + 351 WP_000493378.1 hypothetical protein -
DLD89_RS27820 (DLD89_27815) 131334..132077 + 744 WP_000129823.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid catA1 / dfrA12 / aadA2 / qacE / sul1 / mph(A) / aac(6')-Ib - 1..162490 162490


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T267512 WP_003026803.1 NZ_CP115933:c127291-126809 [Klebsiella pneumoniae subsp. pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT267512 WP_003026799.1 NZ_CP115933:c127545-127279 [Klebsiella pneumoniae subsp. pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References