Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 126809..127545 | Replicon | plasmid pKpUC43_162k |
| Accession | NZ_CP115933 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain 43UC01 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | L7SZ15 |
| Locus tag | DLD89_RS27770 | Protein ID | WP_003026803.1 |
| Coordinates | 126809..127291 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | DLD89_RS27775 | Protein ID | WP_003026799.1 |
| Coordinates | 127279..127545 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DLD89_RS27745 (DLD89_27740) | 121971..122459 | + | 489 | WP_004152114.1 | phosphate-starvation-inducible PsiE family protein | - |
| DLD89_RS27750 (DLD89_27745) | 122446..123408 | + | 963 | WP_004152113.1 | zinc metalloprotease HtpX | - |
| DLD89_RS27755 (DLD89_27750) | 123585..124750 | + | 1166 | Protein_134 | IS3 family transposase | - |
| DLD89_RS27760 (DLD89_27755) | 124959..125090 | - | 132 | WP_004218042.1 | hypothetical protein | - |
| DLD89_RS27765 (DLD89_27760) | 125251..126597 | - | 1347 | WP_020314316.1 | ISNCY family transposase | - |
| DLD89_RS27770 (DLD89_27765) | 126809..127291 | - | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
| DLD89_RS27775 (DLD89_27770) | 127279..127545 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| DLD89_RS27780 (DLD89_27775) | 127721..127975 | - | 255 | WP_004152108.1 | hypothetical protein | - |
| DLD89_RS27785 (DLD89_27780) | 128051..128308 | - | 258 | WP_004152107.1 | hypothetical protein | - |
| DLD89_RS27790 (DLD89_27785) | 128357..128560 | - | 204 | WP_004152106.1 | HHA domain-containing protein | - |
| DLD89_RS27795 (DLD89_27790) | 128594..128962 | - | 369 | WP_004152105.1 | hypothetical protein | - |
| DLD89_RS27800 (DLD89_27795) | 129006..129500 | - | 495 | WP_004152104.1 | DNA-binding protein | - |
| DLD89_RS27805 (DLD89_27800) | 129531..130106 | - | 576 | WP_004152103.1 | hypothetical protein | - |
| DLD89_RS27810 (DLD89_27805) | 130094..130363 | - | 270 | WP_004152102.1 | hypothetical protein | - |
| DLD89_RS27815 (DLD89_27810) | 130933..131283 | + | 351 | WP_000493378.1 | hypothetical protein | - |
| DLD89_RS27820 (DLD89_27815) | 131334..132077 | + | 744 | WP_000129823.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | catA1 / dfrA12 / aadA2 / qacE / sul1 / mph(A) / aac(6')-Ib | - | 1..162490 | 162490 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T267512 WP_003026803.1 NZ_CP115933:c127291-126809 [Klebsiella pneumoniae subsp. pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2GNW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |