Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 32170..32813 Replicon plasmid pKpUC43_114k
Accession NZ_CP115931
Organism Klebsiella pneumoniae subsp. pneumoniae strain 43UC01

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag DLD89_RS26510 Protein ID WP_001044770.1
Coordinates 32170..32586 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag DLD89_RS26515 Protein ID WP_001261282.1
Coordinates 32583..32813 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DLD89_RS26475 (DLD89_26470) 27712..27948 - 237 WP_000993386.1 broad-spectrum mercury transporter MerE -
DLD89_RS26480 (DLD89_26475) 27945..28307 - 363 WP_001277456.1 mercury resistance co-regulator MerD -
DLD89_RS26485 (DLD89_26480) 28325..30019 - 1695 WP_000105636.1 mercury(II) reductase -
DLD89_RS26490 (DLD89_26485) 30071..30493 - 423 WP_001340589.1 organomercurial transporter MerC -
DLD89_RS26495 (DLD89_26490) 30529..30639 - 111 Protein_30 mercuric transport protein periplasmic component -
DLD89_RS26505 (DLD89_26500) 31407..32096 - 690 Protein_32 AAA family ATPase -
DLD89_RS26510 (DLD89_26505) 32170..32586 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
DLD89_RS26515 (DLD89_26510) 32583..32813 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
DLD89_RS26520 (DLD89_26515) 32770..33231 + 462 WP_072093212.1 hypothetical protein -
DLD89_RS26525 (DLD89_26520) 33718..34026 + 309 WP_004152336.1 hypothetical protein -
DLD89_RS26530 (DLD89_26525) 34054..34383 + 330 WP_004152337.1 hypothetical protein -
DLD89_RS26535 (DLD89_26530) 34409..34807 + 399 WP_004171440.1 hypothetical protein -
DLD89_RS26540 (DLD89_26535) 34814..35146 + 333 WP_004152339.1 hypothetical protein -
DLD89_RS26545 (DLD89_26540) 35146..35928 + 783 WP_004152340.1 site-specific integrase -
DLD89_RS26550 (DLD89_26545) 36820..37050 - 231 WP_011977773.1 hypothetical protein -
DLD89_RS26555 (DLD89_26550) 37142..37615 - 474 WP_004152341.1 YkgJ family cysteine cluster protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaKPC-2 / blaTEM-1A - 1..113594 113594
- flank IS/Tn - - 37735..39003 1268


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T267511 WP_001044770.1 NZ_CP115931:c32586-32170 [Klebsiella pneumoniae subsp. pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT267511 WP_001261282.1 NZ_CP115931:c32813-32583 [Klebsiella pneumoniae subsp. pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References