Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4767043..4767559 | Replicon | chromosome |
Accession | NZ_CP115930 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain 43UC01 |
Toxin (Protein)
Gene name | relE | Uniprot ID | J2XDK6 |
Locus tag | DLD89_RS23660 | Protein ID | WP_002886902.1 |
Coordinates | 4767043..4767327 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | DLD89_RS23665 | Protein ID | WP_002886901.1 |
Coordinates | 4767317..4767559 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DLD89_RS23635 (DLD89_23630) | 4762527..4762835 | - | 309 | WP_002886907.1 | PTS sugar transporter subunit IIB | - |
DLD89_RS23640 (DLD89_23635) | 4762920..4763093 | + | 174 | WP_002886906.1 | hypothetical protein | - |
DLD89_RS23645 (DLD89_23640) | 4763096..4763839 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
DLD89_RS23650 (DLD89_23645) | 4764196..4766334 | + | 2139 | WP_002886904.1 | anaerobic ribonucleoside-triphosphate reductase | - |
DLD89_RS23655 (DLD89_23650) | 4766575..4767039 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
DLD89_RS23660 (DLD89_23655) | 4767043..4767327 | - | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DLD89_RS23665 (DLD89_23660) | 4767317..4767559 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
DLD89_RS23670 (DLD89_23665) | 4767637..4769547 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
DLD89_RS23675 (DLD89_23670) | 4769570..4770724 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
DLD89_RS23680 (DLD89_23675) | 4770790..4771530 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T267508 WP_002886902.1 NZ_CP115930:c4767327-4767043 [Klebsiella pneumoniae subsp. pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GMH2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |