Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4052455..4053074 Replicon chromosome
Accession NZ_CP115930
Organism Klebsiella pneumoniae subsp. pneumoniae strain 43UC01

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag DLD89_RS20230 Protein ID WP_002892050.1
Coordinates 4052856..4053074 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag DLD89_RS20225 Protein ID WP_002892066.1
Coordinates 4052455..4052829 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DLD89_RS20215 (DLD89_20210) 4047607..4048800 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
DLD89_RS20220 (DLD89_20215) 4048823..4051969 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
DLD89_RS20225 (DLD89_20220) 4052455..4052829 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
DLD89_RS20230 (DLD89_20225) 4052856..4053074 + 219 WP_002892050.1 HHA domain-containing protein Toxin
DLD89_RS20235 (DLD89_20230) 4053233..4053799 + 567 WP_002892030.1 maltose O-acetyltransferase -
DLD89_RS20240 (DLD89_20235) 4053771..4053911 - 141 WP_004147370.1 hypothetical protein -
DLD89_RS20245 (DLD89_20240) 4053932..4054402 + 471 WP_002892026.1 YlaC family protein -
DLD89_RS20250 (DLD89_20245) 4054377..4055828 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
DLD89_RS20255 (DLD89_20250) 4055929..4056627 + 699 WP_002892021.1 GNAT family protein -
DLD89_RS20260 (DLD89_20255) 4056624..4056764 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
DLD89_RS20265 (DLD89_20260) 4056764..4057027 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T267506 WP_002892050.1 NZ_CP115930:4052856-4053074 [Klebsiella pneumoniae subsp. pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT267506 WP_002892066.1 NZ_CP115930:4052455-4052829 [Klebsiella pneumoniae subsp. pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References