Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 296820..297610 | Replicon | plasmid pAtK224a |
Accession | NZ_CP115926 | ||
Organism | Agrobacterium fabacearum strain K224 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A1S7NFF1 |
Locus tag | G6L41_RS24250 | Protein ID | WP_019565755.1 |
Coordinates | 297113..297610 (+) | Length | 166 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | A0A1S7NER6 |
Locus tag | G6L41_RS24245 | Protein ID | WP_019565754.1 |
Coordinates | 296820..297116 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
G6L41_RS24225 (G6L41_024225) | 292188..293912 | + | 1725 | WP_173994789.1 | ABC transporter ATP-binding protein | - |
G6L41_RS24230 (G6L41_024230) | 293957..295144 | + | 1188 | WP_013637437.1 | galactarate dehydratase | - |
G6L41_RS24235 (G6L41_024235) | 295131..295997 | + | 867 | WP_112497507.1 | aldose 1-epimerase | - |
G6L41_RS24240 (G6L41_024240) | 296207..296637 | + | 431 | Protein_287 | DDE-type integrase/transposase/recombinase | - |
G6L41_RS24245 (G6L41_024245) | 296820..297116 | + | 297 | WP_019565754.1 | DUF1778 domain-containing protein | Antitoxin |
G6L41_RS24250 (G6L41_024250) | 297113..297610 | + | 498 | WP_019565755.1 | GNAT family N-acetyltransferase | Toxin |
G6L41_RS24255 (G6L41_024255) | 297889..298554 | - | 666 | WP_236762315.1 | GNAT family N-acetyltransferase | - |
G6L41_RS24260 (G6L41_024260) | 298520..299680 | - | 1161 | WP_173994787.1 | Gfo/Idh/MocA family oxidoreductase | - |
G6L41_RS24265 (G6L41_024265) | 299712..300962 | - | 1251 | WP_173994786.1 | ROK family transcriptional regulator | - |
G6L41_RS24270 (G6L41_024270) | 301175..302134 | + | 960 | WP_111801318.1 | extracellular solute-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..485342 | 485342 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 17725.27 Da Isoelectric Point: 6.8629
>T267496 WP_019565755.1 NZ_CP115926:297113-297610 [Agrobacterium fabacearum]
VTLSAPVPLADHHELAEFNSGVPELDDWLRRRARANQAGGASRTFVVCDESRVIAYYALASGSVKPPEVPGRFRRNMPDP
IPVAVLGRLAIDQSCQGRGIGRALVRDAGLRLLNAAEVLGIRGVLVHAISDDARAFYEAVGFLSSPSDPMMLMVGLHDLN
NALNT
VTLSAPVPLADHHELAEFNSGVPELDDWLRRRARANQAGGASRTFVVCDESRVIAYYALASGSVKPPEVPGRFRRNMPDP
IPVAVLGRLAIDQSCQGRGIGRALVRDAGLRLLNAAEVLGIRGVLVHAISDDARAFYEAVGFLSSPSDPMMLMVGLHDLN
NALNT
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1S7NFF1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1S7NER6 |