Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 284296..284966 | Replicon | plasmid pAtK224a |
| Accession | NZ_CP115926 | ||
| Organism | Agrobacterium fabacearum strain K224 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | G6L41_RS24190 | Protein ID | WP_173994792.1 |
| Coordinates | 284547..284966 (+) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | F0LGD9 |
| Locus tag | G6L41_RS24185 | Protein ID | WP_003517203.1 |
| Coordinates | 284296..284550 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G6L41_RS24175 (G6L41_024175) | 281784..282785 | + | 1002 | WP_003517209.1 | sensor histidine kinase | - |
| G6L41_RS24180 (G6L41_024180) | 283320..283925 | - | 606 | WP_065703247.1 | J domain-containing protein | - |
| G6L41_RS24185 (G6L41_024185) | 284296..284550 | + | 255 | WP_003517203.1 | plasmid stabilization protein | Antitoxin |
| G6L41_RS24190 (G6L41_024190) | 284547..284966 | + | 420 | WP_173994792.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| G6L41_RS24195 (G6L41_024195) | 285106..286002 | - | 897 | WP_013637432.1 | dihydrodipicolinate synthase family protein | - |
| G6L41_RS24200 (G6L41_024200) | 286035..286916 | - | 882 | WP_173994791.1 | SMP-30/gluconolactonase/LRE family protein | - |
| G6L41_RS24205 (G6L41_024205) | 286973..287692 | - | 720 | WP_003517195.1 | FCD domain-containing protein | - |
| G6L41_RS24210 (G6L41_024210) | 287992..289941 | + | 1950 | WP_060643031.1 | ABC transporter substrate-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..485342 | 485342 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15149.38 Da Isoelectric Point: 5.8701
>T267495 WP_173994792.1 NZ_CP115926:284547-284966 [Agrobacterium fabacearum]
MILLDTNVISEPWKPVPDEAVIAWLDAQAVETLFISAITIAELRFGIAAMPSGRRQTILRDRLEGEVLPHFSGRILSFDL
TTSQFYSELMARARATRKAIGTADGYIAATAAANGLTISTRDTSPFEAAGVKVINPWSR
MILLDTNVISEPWKPVPDEAVIAWLDAQAVETLFISAITIAELRFGIAAMPSGRRQTILRDRLEGEVLPHFSGRILSFDL
TTSQFYSELMARARATRKAIGTADGYIAATAAANGLTISTRDTSPFEAAGVKVINPWSR
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|