Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 152052..152632 Replicon plasmid pAtK224a
Accession NZ_CP115926
Organism Agrobacterium fabacearum strain K224

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag G6L41_RS23530 Protein ID WP_080802578.1
Coordinates 152052..152435 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID F0LFX8
Locus tag G6L41_RS23535 Protein ID WP_013637280.1
Coordinates 152432..152632 (-) Length 67 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
G6L41_RS23495 (G6L41_023495) 147485..148117 - 633 WP_173994638.1 TetR/AcrR family transcriptional regulator -
G6L41_RS23500 (G6L41_023500) 148240..149118 + 879 WP_173994637.1 SDR family oxidoreductase -
G6L41_RS23505 (G6L41_023505) 149132..149557 + 426 WP_173994636.1 organic hydroperoxide resistance protein -
G6L41_RS23510 (G6L41_023510) 149792..150082 + 291 WP_173994635.1 DUF1330 domain-containing protein -
G6L41_RS23515 (G6L41_023515) 150310..150462 + 153 Protein_142 aromatic alcohol reductase -
G6L41_RS23520 (G6L41_023520) 150467..150655 - 189 Protein_143 DDE-type integrase/transposase/recombinase -
G6L41_RS23525 (G6L41_023525) 150744..151640 - 897 WP_173994633.1 transglutaminase family protein -
G6L41_RS23530 (G6L41_023530) 152052..152435 - 384 WP_080802578.1 type II toxin-antitoxin system VapC family toxin Toxin
G6L41_RS23535 (G6L41_023535) 152432..152632 - 201 WP_013637280.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
G6L41_RS23540 (G6L41_023540) 152857..153798 - 942 WP_173994632.1 AraC family transcriptional regulator -
G6L41_RS23545 (G6L41_023545) 153890..154867 + 978 WP_173994631.1 oxidoreductase -
G6L41_RS23550 (G6L41_023550) 155133..155579 - 447 WP_003517456.1 carboxymuconolactone decarboxylase family protein -
G6L41_RS23555 (G6L41_023555) 155672..156109 - 438 WP_003517453.1 cupin domain-containing protein -
G6L41_RS23560 (G6L41_023560) 156123..156875 - 753 WP_173994630.1 NAD(P)H-binding protein -
G6L41_RS23565 (G6L41_023565) 156887..157399 - 513 WP_019565668.1 Rrf2 family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..485342 485342


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-112)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-42)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 14237.29 Da        Isoelectric Point: 6.6030

>T267493 WP_080802578.1 NZ_CP115926:c152435-152052 [Agrobacterium fabacearum]
VILVDTSIWIDHFRYDDSELRKIINDDQLLCHPFVVGELALGSLRERAAVLEFLTAQREALIATHAEVMTVIDRHSIFSM
GIGYTDAHLLTSTLLDRRSSLWTRDKRLAAAAQKVGAALYPHAQASH

Download         Length: 384 bp

Antitoxin


Download         Length: 67 a.a.        Molecular weight: 7197.28 Da        Isoelectric Point: 10.7407

>AT267493 WP_013637280.1 NZ_CP115926:c152632-152432 [Agrobacterium fabacearum]
MRSTINIDDNLMERAKSLTGTKETAALVRQALETLVRVESGKRLIALGGSMPEAEASPRRRSDVAK

Download         Length: 201 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB F0LFX8

References