Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 259502..260145 | Replicon | chromosome |
Accession | NZ_CP115914 | ||
Organism | Priestia filamentosa strain AZC66 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A329EQQ9 |
Locus tag | PGN40_RS01365 | Protein ID | WP_019395220.1 |
Coordinates | 259795..260145 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | PGN40_RS01360 | Protein ID | WP_074842893.1 |
Coordinates | 259502..259789 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PGN40_RS01335 (PGN40_01335) | 254658..255635 | + | 978 | WP_120045889.1 | UV DNA damage repair endonuclease UvsE | - |
PGN40_RS01340 (PGN40_01340) | 255658..256245 | - | 588 | WP_046218254.1 | rhomboid family intramembrane serine protease | - |
PGN40_RS01345 (PGN40_01345) | 256418..256774 | + | 357 | WP_019395216.1 | holo-ACP synthase | - |
PGN40_RS01350 (PGN40_01350) | 256876..257883 | + | 1008 | WP_046218253.1 | outer membrane lipoprotein carrier protein LolA | - |
PGN40_RS01355 (PGN40_01355) | 258080..259237 | + | 1158 | WP_216700785.1 | alanine racemase | - |
PGN40_RS01360 (PGN40_01360) | 259502..259789 | + | 288 | WP_074842893.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
PGN40_RS01365 (PGN40_01365) | 259795..260145 | + | 351 | WP_019395220.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PGN40_RS01370 (PGN40_01370) | 260436..261269 | + | 834 | WP_272541790.1 | STAS domain-containing protein | - |
PGN40_RS01375 (PGN40_01375) | 261272..261628 | + | 357 | WP_019395222.1 | STAS domain-containing protein | - |
PGN40_RS01380 (PGN40_01380) | 261631..262032 | + | 402 | WP_019395223.1 | anti-sigma regulatory factor | - |
PGN40_RS01385 (PGN40_01385) | 262044..263054 | + | 1011 | WP_040059882.1 | PP2C family protein-serine/threonine phosphatase | - |
PGN40_RS01390 (PGN40_01390) | 263112..263444 | + | 333 | WP_019395225.1 | STAS domain-containing protein | - |
PGN40_RS01395 (PGN40_01395) | 263441..263923 | + | 483 | WP_019395226.1 | anti-sigma B factor RsbW | - |
PGN40_RS01400 (PGN40_01400) | 263889..264683 | + | 795 | WP_019395227.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12919.04 Da Isoelectric Point: 8.5368
>T267490 WP_019395220.1 NZ_CP115914:259795-260145 [Priestia filamentosa]
MVVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTVIVAAITAQIQKAKLPTHVEINAKKYGFERDSVILLEQV
RTIDKQRLTDKITHLDEEMMSKVDKALQISLGLIDF
MVVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTVIVAAITAQIQKAKLPTHVEINAKKYGFERDSVILLEQV
RTIDKQRLTDKITHLDEEMMSKVDKALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|