Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 973660..974315 | Replicon | chromosome |
Accession | NZ_CP115904 | ||
Organism | Neisseria gonorrhoeae strain MS11 HL-1-22 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q5F882 |
Locus tag | OK782_RS05075 | Protein ID | WP_003691083.1 |
Coordinates | 973660..974079 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q5F881 |
Locus tag | OK782_RS05080 | Protein ID | WP_003688410.1 |
Coordinates | 974079..974315 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OK782_RS05055 (OK782_05055) | 968894..970435 | - | 1542 | WP_003688418.1 | MDR family MFS transporter | - |
OK782_RS05060 (OK782_05060) | 970583..971362 | + | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
OK782_RS05065 (OK782_05065) | 971359..972060 | + | 702 | WP_003688414.1 | lactate utilization protein C | - |
OK782_RS05070 (OK782_05070) | 972057..973511 | + | 1455 | WP_003688412.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
OK782_RS05075 (OK782_05075) | 973660..974079 | - | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
OK782_RS05080 (OK782_05080) | 974079..974315 | - | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
OK782_RS05085 (OK782_05085) | 974763..975341 | - | 579 | WP_003688041.1 | IS3 family transposase | - |
OK782_RS05090 (OK782_05090) | 975346..975747 | - | 402 | WP_020997337.1 | helix-turn-helix domain-containing protein | - |
OK782_RS05095 (OK782_05095) | 975986..976372 | + | 387 | Protein_1000 | IS110 family transposase | - |
OK782_RS05100 (OK782_05100) | 976755..977645 | - | 891 | WP_003688409.1 | succinate--CoA ligase subunit alpha | - |
OK782_RS05105 (OK782_05105) | 977656..978822 | - | 1167 | WP_003688408.1 | ADP-forming succinate--CoA ligase subunit beta | - |
OK782_RS05110 (OK782_05110) | 978894..979181 | - | 288 | WP_003688407.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T267483 WP_003691083.1 NZ_CP115904:c974079-973660 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|