Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 948900..949555 | Replicon | chromosome |
| Accession | NZ_CP115904 | ||
| Organism | Neisseria gonorrhoeae strain MS11 HL-1-22 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | Q5F882 |
| Locus tag | OK782_RS04945 | Protein ID | WP_003691083.1 |
| Coordinates | 948900..949319 (-) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | Q5F881 |
| Locus tag | OK782_RS04950 | Protein ID | WP_003688410.1 |
| Coordinates | 949319..949555 (-) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OK782_RS04925 (OK782_04925) | 944134..945675 | - | 1542 | WP_003688418.1 | MDR family MFS transporter | - |
| OK782_RS04930 (OK782_04930) | 945823..946602 | + | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
| OK782_RS04935 (OK782_04935) | 946599..947300 | + | 702 | WP_003688414.1 | lactate utilization protein C | - |
| OK782_RS04940 (OK782_04940) | 947297..948751 | + | 1455 | WP_003688412.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
| OK782_RS04945 (OK782_04945) | 948900..949319 | - | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
| OK782_RS04950 (OK782_04950) | 949319..949555 | - | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
| OK782_RS04955 (OK782_04955) | 950003..950581 | - | 579 | WP_003688041.1 | IS3 family transposase | - |
| OK782_RS04960 (OK782_04960) | 950586..950987 | - | 402 | WP_020997337.1 | helix-turn-helix domain-containing protein | - |
| OK782_RS04965 (OK782_04965) | 951170..951642 | + | 473 | Protein_975 | IS630 transposase-related protein | - |
| OK782_RS04970 (OK782_04970) | 951684..951854 | - | 171 | WP_003688501.1 | rubredoxin | - |
| OK782_RS04975 (OK782_04975) | 951987..953069 | - | 1083 | WP_003688497.1 | acyl-CoA dehydrogenase family protein | - |
| OK782_RS04980 (OK782_04980) | 953205..953753 | - | 549 | WP_003695147.1 | carboxymuconolactone decarboxylase family protein | - |
| OK782_RS04985 (OK782_04985) | 953893..954264 | - | 372 | WP_003688492.1 | DUF2628 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 949761..950006 | 245 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T267482 WP_003691083.1 NZ_CP115904:c949319-948900 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|