Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 141541..142184 | Replicon | plasmid p277859 |
Accession | NZ_CP115897 | ||
Organism | Kalamiella piersonii strain URMC-2103A041 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | PG877_RS21845 | Protein ID | WP_120456617.1 |
Coordinates | 141541..141957 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | - |
Locus tag | PG877_RS21850 | Protein ID | WP_120456616.1 |
Coordinates | 141954..142184 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PG877_RS21835 (PG877_21835) | 136988..139390 | + | 2403 | WP_271153539.1 | maltodextrin phosphorylase | - |
PG877_RS21840 (PG877_21840) | 139399..141468 | + | 2070 | WP_271153421.1 | 4-alpha-glucanotransferase | - |
PG877_RS21845 (PG877_21845) | 141541..141957 | - | 417 | WP_120456617.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PG877_RS21850 (PG877_21850) | 141954..142184 | - | 231 | WP_120456616.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PG877_RS21855 (PG877_21855) | 142329..143243 | - | 915 | WP_271153422.1 | maltose operon protein MalM | - |
PG877_RS21860 (PG877_21860) | 143360..144661 | - | 1302 | WP_120456612.1 | maltoporin | - |
PG877_RS21865 (PG877_21865) | 144703..145812 | - | 1110 | WP_120456610.1 | maltose/maltodextrin ABC transporter ATP-binding protein MalK | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | iutA / iucC / hsiC1/vipB | 1..277859 | 277859 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15174.55 Da Isoelectric Point: 7.1082
>T267481 WP_120456617.1 NZ_CP115897:c141957-141541 [Kalamiella piersonii]
VSKTYMLDTNICSFIMREQPEAVLMRLEQAVLRRDRIVVSAITYAEMRFGAIGKKASPRHAQLVEAFCARLDAILPWDRN
AVDATTEIKAALTAAGNPIGPNDTAIAGHAIATSAILVTNNIKEFERVPGLTFEDWCK
VSKTYMLDTNICSFIMREQPEAVLMRLEQAVLRRDRIVVSAITYAEMRFGAIGKKASPRHAQLVEAFCARLDAILPWDRN
AVDATTEIKAALTAAGNPIGPNDTAIAGHAIATSAILVTNNIKEFERVPGLTFEDWCK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|