Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 2899981..2900600 Replicon chromosome
Accession NZ_CP115895
Organism Kalamiella piersonii strain URMC-2103A041

Toxin (Protein)


Gene name Hha Uniprot ID -
Locus tag PG877_RS14140 Protein ID WP_120451305.1
Coordinates 2900382..2900600 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID -
Locus tag PG877_RS14135 Protein ID WP_120451306.1
Coordinates 2899981..2900358 (+) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PG877_RS14105 (PG877_14105) 2896289..2896540 + 252 WP_120451311.1 type B 50S ribosomal protein L31 -
PG877_RS14110 (PG877_14110) 2896552..2896692 + 141 WP_071997379.1 type B 50S ribosomal protein L36 -
PG877_RS14115 (PG877_14115) 2896734..2897612 - 879 WP_120451310.1 metal ABC transporter substrate-binding protein -
PG877_RS14120 (PG877_14120) 2897625..2898464 - 840 WP_271152263.1 metal ABC transporter permease -
PG877_RS14125 (PG877_14125) 2898461..2899126 - 666 WP_120451308.1 ABC transporter ATP-binding protein -
PG877_RS14130 (PG877_14130) 2899479..2899832 + 354 WP_120451307.1 hypothetical protein -
PG877_RS14135 (PG877_14135) 2899981..2900358 + 378 WP_120451306.1 Hha toxicity modulator TomB Antitoxin
PG877_RS14140 (PG877_14140) 2900382..2900600 + 219 WP_120451305.1 HHA domain-containing protein Toxin
PG877_RS14150 (PG877_14150) 2900987..2901298 + 312 WP_120451304.1 MGMT family protein -
PG877_RS14155 (PG877_14155) 2901331..2901888 - 558 WP_120451303.1 YbaY family lipoprotein -
PG877_RS14160 (PG877_14160) 2902078..2902941 + 864 WP_120451302.1 acyl-CoA thioesterase II -
PG877_RS14165 (PG877_14165) 2903060..2904352 - 1293 WP_120451301.1 ammonium transporter AmtB -
PG877_RS14170 (PG877_14170) 2904386..2904724 - 339 WP_033752690.1 P-II family nitrogen regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-114)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8601.92 Da        Isoelectric Point: 8.9007

>T267479 WP_120451305.1 NZ_CP115895:2900382-2900600 [Kalamiella piersonii]
MNDKTLTKTDYLMRLRRCRSIDTLERVIEKNKYELSDDELAVFYSAADHRLAELTMNKLYDKVPGSVWKFVR

Download         Length: 219 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 14763.31 Da        Isoelectric Point: 4.3276

>AT267479 WP_120451306.1 NZ_CP115895:2899981-2900358 [Kalamiella piersonii]
MDEYSPKRHDIAQLKFLCENLFDESMATLTDSHHGWVNDPTSENNLQLNDLIEHIASFTMNYKIKHAEDEDLITQIDDYL
DDTFMLFTNYGINAQDLNRWQRSARRLFNLFSEECAYLQQPSHSI

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References