Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1397466..1398110 | Replicon | chromosome |
Accession | NZ_CP115895 | ||
Organism | Kalamiella piersonii strain URMC-2103A041 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | PG877_RS06675 | Protein ID | WP_271152916.1 |
Coordinates | 1397934..1398110 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | PG877_RS06670 | Protein ID | WP_120453379.1 |
Coordinates | 1397466..1397870 (-) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PG877_RS06650 (PG877_06650) | 1392484..1393278 | + | 795 | WP_271152914.1 | HPr family phosphocarrier protein | - |
PG877_RS06655 (PG877_06655) | 1393391..1394746 | + | 1356 | WP_120453375.1 | GntP family transporter | - |
PG877_RS06660 (PG877_06660) | 1394846..1395871 | + | 1026 | WP_271152915.1 | Gfo/Idh/MocA family oxidoreductase | - |
PG877_RS06665 (PG877_06665) | 1395899..1397329 | - | 1431 | WP_179256388.1 | exodeoxyribonuclease I | - |
PG877_RS06670 (PG877_06670) | 1397466..1397870 | - | 405 | WP_120453379.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PG877_RS06675 (PG877_06675) | 1397934..1398110 | - | 177 | WP_271152916.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PG877_RS06680 (PG877_06680) | 1398167..1398313 | - | 147 | WP_271152917.1 | hypothetical protein | - |
PG877_RS06685 (PG877_06685) | 1398378..1399541 | + | 1164 | WP_179256389.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
PG877_RS06690 (PG877_06690) | 1399576..1400793 | - | 1218 | WP_271152918.1 | cytochrome c | - |
PG877_RS06695 (PG877_06695) | 1400790..1402553 | - | 1764 | WP_120453385.1 | GMC family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6760.10 Da Isoelectric Point: 11.1683
>T267474 WP_271152916.1 NZ_CP115895:c1398110-1397934 [Kalamiella piersonii]
MSSKEVMKLLREHGWVFVRIRGSHHLFVKPGKNYHITLPHPEKDLAAGTLRKIMKLIN
MSSKEVMKLLREHGWVFVRIRGSHHLFVKPGKNYHITLPHPEKDLAAGTLRKIMKLIN
Download Length: 177 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14798.73 Da Isoelectric Point: 4.5232
>AT267474 WP_120453379.1 NZ_CP115895:c1397870-1397466 [Kalamiella piersonii]
MRFPVYLHQTDSGSYSGFVPDIEGCFFAGETVDDAILDAGAAIDIHLEALAESGMPVPHTKGMAFYLESDECQGGIWAVI
DIDISKYEGKAVKLNITLPQSLLTRIDRFVESHQEFSSRSGFLAELARRELAKR
MRFPVYLHQTDSGSYSGFVPDIEGCFFAGETVDDAILDAGAAIDIHLEALAESGMPVPHTKGMAFYLESDECQGGIWAVI
DIDISKYEGKAVKLNITLPQSLLTRIDRFVESHQEFSSRSGFLAELARRELAKR
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|