Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 1935747..1936523 | Replicon | chromosome |
| Accession | NZ_CP115887 | ||
| Organism | Staphylococcus aureus strain C308 | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | - |
| Locus tag | PCM89_RS09325 | Protein ID | WP_000031112.1 |
| Coordinates | 1935747..1935899 (-) | Length | 51 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | W8U4V4 |
| Locus tag | PCM89_RS09330 | Protein ID | WP_001251224.1 |
| Coordinates | 1935924..1936523 (-) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PCM89_RS09310 (1931653) | 1931653..1932474 | + | 822 | WP_000669382.1 | RluA family pseudouridine synthase | - |
| PCM89_RS09315 (1932936) | 1932936..1934321 | - | 1386 | WP_000116232.1 | class II fumarate hydratase | - |
| PCM89_RS09320 (1934517) | 1934517..1934912 | - | 396 | WP_000901023.1 | hypothetical protein | - |
| PCM89_RS09325 (1935747) | 1935747..1935899 | - | 153 | WP_000031112.1 | SAS053 family protein | Toxin |
| PCM89_RS09330 (1935924) | 1935924..1936523 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
| PCM89_RS09335 (1936682) | 1936682..1937152 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| PCM89_RS09340 (1937157) | 1937157..1938284 | - | 1128 | WP_000379980.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| PCM89_RS09345 (1938434) | 1938434..1939156 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
| PCM89_RS09350 (1939149) | 1939149..1940606 | - | 1458 | WP_000649910.1 | ABC transporter permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5966.31 Da Isoelectric Point: 3.8962
>T267464 WP_000031112.1 NZ_CP115887:c1935899-1935747 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELSKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELSKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT267464 WP_001251224.1 NZ_CP115887:c1936523-1935924 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|