Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 2261645..2262384 | Replicon | chromosome |
| Accession | NZ_CP115874 | ||
| Organism | Enterobacter hormaechei subsp. steigerwaltii strain WYTS.MG41 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A822W909 |
| Locus tag | PBS85_RS10655 | Protein ID | WP_017382345.1 |
| Coordinates | 2261645..2262130 (-) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A837FCR9 |
| Locus tag | PBS85_RS10660 | Protein ID | WP_003857131.1 |
| Coordinates | 2262118..2262384 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PBS85_RS10625 (PBS85_10625) | 2256675..2257433 | + | 759 | WP_015570520.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PBS85_RS10630 (PBS85_10630) | 2257538..2258830 | + | 1293 | WP_271139147.1 | glycosyl hydrolase family 28 protein | - |
| PBS85_RS10635 (PBS85_10635) | 2258899..2259444 | + | 546 | WP_032671141.1 | NUDIX hydrolase | - |
| PBS85_RS10640 (PBS85_10640) | 2259628..2260263 | - | 636 | WP_015570517.1 | DUF421 domain-containing protein | - |
| PBS85_RS10645 (PBS85_10645) | 2260273..2260719 | - | 447 | WP_014069654.1 | DUF3290 domain-containing protein | - |
| PBS85_RS10650 (PBS85_10650) | 2261148..2261464 | - | 317 | Protein_2074 | ISNCY family transposase | - |
| PBS85_RS10655 (PBS85_10655) | 2261645..2262130 | - | 486 | WP_017382345.1 | GNAT family N-acetyltransferase | Toxin |
| PBS85_RS10660 (PBS85_10660) | 2262118..2262384 | - | 267 | WP_003857131.1 | DUF1778 domain-containing protein | Antitoxin |
| PBS85_RS10665 (PBS85_10665) | 2262448..2263377 | - | 930 | WP_271139148.1 | LysR family transcriptional regulator | - |
| PBS85_RS10670 (PBS85_10670) | 2263507..2264895 | + | 1389 | WP_032619651.1 | MFS transporter | - |
| PBS85_RS10675 (PBS85_10675) | 2264917..2265912 | - | 996 | WP_023303746.1 | DUF2891 domain-containing protein | - |
| PBS85_RS10680 (PBS85_10680) | 2265922..2266908 | - | 987 | WP_017382341.1 | DUF979 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2246262..2262384 | 16122 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17510.21 Da Isoelectric Point: 9.9658
>T267446 WP_017382345.1 NZ_CP115874:c2262130-2261645 [Enterobacter hormaechei subsp. steigerwaltii]
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARAFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARAFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A822W909 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FCR9 |