Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 240397..241039 | Replicon | chromosome |
| Accession | NZ_CP115856 | ||
| Organism | Bacillus cereus strain PL22-16A | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | J8CWW5 |
| Locus tag | PFY08_RS01370 | Protein ID | WP_000635963.1 |
| Coordinates | 240689..241039 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | R8I8H2 |
| Locus tag | PFY08_RS01365 | Protein ID | WP_000004570.1 |
| Coordinates | 240397..240684 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PFY08_RS01340 (PFY08_01340) | 235714..236676 | + | 963 | WP_000961166.1 | UV DNA damage repair endonuclease UvsE | - |
| PFY08_RS01345 (PFY08_01345) | 236669..237241 | - | 573 | WP_000586917.1 | rhomboid family intramembrane serine protease | - |
| PFY08_RS01350 (PFY08_01350) | 237335..237694 | + | 360 | WP_000583416.1 | holo-ACP synthase | - |
| PFY08_RS01355 (PFY08_01355) | 237851..238801 | + | 951 | WP_071740808.1 | outer membrane lipoprotein carrier protein LolA | - |
| PFY08_RS01360 (PFY08_01360) | 238919..240088 | + | 1170 | WP_000390615.1 | alanine racemase | - |
| PFY08_RS01365 (PFY08_01365) | 240397..240684 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
| PFY08_RS01370 (PFY08_01370) | 240689..241039 | + | 351 | WP_000635963.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| PFY08_RS01375 (PFY08_01375) | 241107..243275 | + | 2169 | WP_000426242.1 | Tex family protein | - |
| PFY08_RS01380 (PFY08_01380) | 243333..243449 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
| PFY08_RS01385 (PFY08_01385) | 243645..244103 | + | 459 | WP_071740807.1 | SprT family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12974.12 Da Isoelectric Point: 5.7168
>T267439 WP_000635963.1 NZ_CP115856:240689-241039 [Bacillus cereus]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 4HKE | |
| PDB | 7BXY |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A366FY90 |