Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 385751..386421 | Replicon | plasmid pAtG3_79a |
| Accession | NZ_CP115843 | ||
| Organism | Agrobacterium fabacearum strain G3/79 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | G6L97_RS25070 | Protein ID | WP_003517201.1 |
| Coordinates | 386002..386421 (+) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | F0LGD9 |
| Locus tag | G6L97_RS25065 | Protein ID | WP_003517203.1 |
| Coordinates | 385751..386005 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G6L97_RS25035 (G6L97_25035) | 380781..381569 | + | 789 | WP_025591510.1 | ABC transporter permease | - |
| G6L97_RS25040 (G6L97_25040) | 381571..383079 | + | 1509 | WP_174004087.1 | carboxylesterase family protein | - |
| G6L97_RS25045 (G6L97_25045) | 383128..384075 | + | 948 | WP_080802808.1 | LysR family transcriptional regulator | - |
| G6L97_RS25050 (G6L97_25050) | 384232..384540 | + | 309 | WP_112497505.1 | hypothetical protein | - |
| G6L97_RS25055 (G6L97_25055) | 384779..384985 | - | 207 | WP_025591519.1 | hypothetical protein | - |
| G6L97_RS25060 (G6L97_25060) | 385236..385463 | + | 228 | Protein_376 | acetolactate synthase | - |
| G6L97_RS25065 (G6L97_25065) | 385751..386005 | + | 255 | WP_003517203.1 | plasmid stabilization protein | Antitoxin |
| G6L97_RS25070 (G6L97_25070) | 386002..386421 | + | 420 | WP_003517201.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| G6L97_RS25075 (G6L97_25075) | 386648..387544 | - | 897 | WP_174004089.1 | dihydrodipicolinate synthase family protein | - |
| G6L97_RS25080 (G6L97_25080) | 387577..388458 | - | 882 | WP_111801762.1 | SMP-30/gluconolactonase/LRE family protein | - |
| G6L97_RS25085 (G6L97_25085) | 388515..389234 | - | 720 | WP_174004091.1 | FadR/GntR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..632660 | 632660 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15036.22 Da Isoelectric Point: 5.1532
>T267436 WP_003517201.1 NZ_CP115843:386002-386421 [Agrobacterium fabacearum]
MILLDTNVISEPWKPVPDEAVIAWLDAQAVETLFISAITIAELRFGIAAMPSGRRQTILRDRLEGEVLPHFSGRILSFDL
TTSQFYSELMARARASGKAIGTADGYIAATAAANGLTISTRDTSPFEAAGVKVINPWSR
MILLDTNVISEPWKPVPDEAVIAWLDAQAVETLFISAITIAELRFGIAAMPSGRRQTILRDRLEGEVLPHFSGRILSFDL
TTSQFYSELMARARASGKAIGTADGYIAATAAANGLTISTRDTSPFEAAGVKVINPWSR
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|