Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/CC2985(antitoxin) |
| Location | 241813..242360 | Replicon | plasmid pAtG3_79a |
| Accession | NZ_CP115843 | ||
| Organism | Agrobacterium fabacearum strain G3/79 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | G6L97_RS24360 | Protein ID | WP_141194105.1 |
| Coordinates | 242067..242360 (+) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | F0LFW5 |
| Locus tag | G6L97_RS24355 | Protein ID | WP_013637268.1 |
| Coordinates | 241813..242067 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G6L97_RS24340 (G6L97_24340) | 237360..238202 | - | 843 | WP_065706101.1 | MaoC family dehydratase N-terminal domain-containing protein | - |
| G6L97_RS24345 (G6L97_24345) | 238275..239357 | - | 1083 | WP_065706102.1 | LLM class flavin-dependent oxidoreductase | - |
| G6L97_RS24350 (G6L97_24350) | 240379..241617 | + | 1239 | WP_174004015.1 | Fic family protein | - |
| G6L97_RS24355 (G6L97_24355) | 241813..242067 | + | 255 | WP_013637268.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| G6L97_RS24360 (G6L97_24360) | 242067..242360 | + | 294 | WP_141194105.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| G6L97_RS24365 (G6L97_24365) | 242709..243140 | - | 432 | WP_065706103.1 | helix-turn-helix domain-containing protein | - |
| G6L97_RS24370 (G6L97_24370) | 243268..243564 | + | 297 | WP_003519127.1 | YciI family protein | - |
| G6L97_RS24375 (G6L97_24375) | 243634..244413 | + | 780 | WP_174004017.1 | SDR family oxidoreductase | - |
| G6L97_RS24380 (G6L97_24380) | 244493..245308 | + | 816 | WP_174004019.1 | oxidoreductase | - |
| G6L97_RS24385 (G6L97_24385) | 246117..246341 | - | 225 | WP_198927209.1 | NAD(P)-binding domain-containing protein | - |
| G6L97_RS24390 (G6L97_24390) | 246598..246909 | + | 312 | WP_038496292.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..632660 | 632660 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11192.88 Da Isoelectric Point: 6.2131
>T267435 WP_141194105.1 NZ_CP115843:242067-242360 [Agrobacterium fabacearum]
MPFSLSVQAEEDIISIAEECIRIFGALVARQYHDELFALLELIATNPRMARERHEISPPVRIHPFKAHLVVYRIIEDGSV
FVIRIRHGHEDWAGNSF
MPFSLSVQAEEDIISIAEECIRIFGALVARQYHDELFALLELIATNPRMARERHEISPPVRIHPFKAHLVVYRIIEDGSV
FVIRIRHGHEDWAGNSF
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|