Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hipBA/HipA-couple_hipB |
Location | 2128575..2130085 | Replicon | chromosome |
Accession | NZ_CP115842 | ||
Organism | Agrobacterium fabacearum strain G3/79 |
Toxin (Protein)
Gene name | HipA1 | Uniprot ID | F0LBK0 |
Locus tag | G6L97_RS23125 | Protein ID | WP_013762466.1 |
Coordinates | 2128844..2130085 (+) | Length | 414 a.a. |
Antitoxin (Protein)
Gene name | HipB1 | Uniprot ID | F0LBJ9 |
Locus tag | G6L97_RS23120 | Protein ID | WP_013762465.1 |
Coordinates | 2128575..2128847 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
G6L97_RS23075 (G6L97_23075) | 2123661..2124062 | - | 402 | WP_013762456.1 | hypothetical protein | - |
G6L97_RS23080 (G6L97_23080) | 2124101..2124316 | - | 216 | WP_019567388.1 | hypothetical protein | - |
G6L97_RS23085 (G6L97_23085) | 2124657..2124779 | + | 123 | WP_003518941.1 | hypothetical protein | - |
G6L97_RS23090 (G6L97_23090) | 2124980..2125639 | - | 660 | WP_013762458.1 | porin family protein | - |
G6L97_RS23095 (G6L97_23095) | 2125847..2126230 | - | 384 | WP_025594780.1 | ester cyclase | - |
G6L97_RS23100 (G6L97_23100) | 2126301..2126921 | - | 621 | WP_025594779.1 | histidine phosphatase family protein | - |
G6L97_RS23105 (G6L97_23105) | 2126899..2127468 | - | 570 | Protein_1864 | AAA family ATPase | - |
G6L97_RS23110 (G6L97_23110) | 2127581..2127709 | - | 129 | WP_003518932.1 | hypothetical protein | - |
G6L97_RS23115 (G6L97_23115) | 2127833..2128153 | - | 321 | WP_013762464.1 | hypothetical protein | - |
G6L97_RS23120 (G6L97_23120) | 2128575..2128847 | + | 273 | WP_013762465.1 | helix-turn-helix domain-containing protein | Antitoxin |
G6L97_RS23125 (G6L97_23125) | 2128844..2130085 | + | 1242 | WP_013762466.1 | type II toxin-antitoxin system HipA family toxin | Toxin |
G6L97_RS23130 (G6L97_23130) | 2130075..2130215 | + | 141 | WP_156390030.1 | hypothetical protein | - |
G6L97_RS23135 (G6L97_23135) | 2131238..2132332 | + | 1095 | WP_013762468.1 | helix-turn-helix transcriptional regulator | - |
G6L97_RS23140 (G6L97_23140) | 2132966..2133091 | + | 126 | WP_256372464.1 | hypothetical protein | - |
G6L97_RS23145 (G6L97_23145) | 2133704..2133976 | + | 273 | WP_029658823.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
G6L97_RS23150 (G6L97_23150) | 2133963..2134085 | + | 123 | Protein_1873 | plasmid maintenance toxin (PemK-like) | - |
G6L97_RS23155 (G6L97_23155) | 2134257..2134466 | + | 210 | WP_174003888.1 | hypothetical protein | - |
G6L97_RS23160 (G6L97_23160) | 2134662..2134934 | + | 273 | WP_236735824.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 414 a.a. Molecular weight: 45352.22 Da Isoelectric Point: 7.8873
>T267434 WP_013762466.1 NZ_CP115842:2128844-2130085 [Agrobacterium fabacearum]
MTTIYYETLPVAHLTFEGEWRLDYDPGWEARRPAFPVSLTMPLRSGSVGAAKLLPWLANLLPETHLAEIGQRFKVSPQDI
VGLLAHIGRDTAGALSIGEPRKAGVNLRPVPDEQALERILNELPAKPFLVGERGVSMSLAGVQEKLPVFVDGNGRISVPV
DGTPSTHILKPDTKRLAGSVENEAFCLSLARACGLEAAEATIGVAGKRRYLLVKRYDRFTDPQGEIRRLHQEDLCQLTGC
FPSQKYERSSTGRGVTMKMMFDAVSDLVSPGERLKLLDAVIFNVLICNSDSHAKNYSILIGAGGSAKMAPLYDLMCAAVY
RQVDQSLPQGIFGRFHAPDLRRADWQALADDIGLSGASTLKRVGELAKLVSVACDEVAPYIVALSSDPTRILERITHSVQ
KRCRRIQEQMHDR
MTTIYYETLPVAHLTFEGEWRLDYDPGWEARRPAFPVSLTMPLRSGSVGAAKLLPWLANLLPETHLAEIGQRFKVSPQDI
VGLLAHIGRDTAGALSIGEPRKAGVNLRPVPDEQALERILNELPAKPFLVGERGVSMSLAGVQEKLPVFVDGNGRISVPV
DGTPSTHILKPDTKRLAGSVENEAFCLSLARACGLEAAEATIGVAGKRRYLLVKRYDRFTDPQGEIRRLHQEDLCQLTGC
FPSQKYERSSTGRGVTMKMMFDAVSDLVSPGERLKLLDAVIFNVLICNSDSHAKNYSILIGAGGSAKMAPLYDLMCAAVY
RQVDQSLPQGIFGRFHAPDLRRADWQALADDIGLSGASTLKRVGELAKLVSVACDEVAPYIVALSSDPTRILERITHSVQ
KRCRRIQEQMHDR
Download Length: 1242 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|