Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4698593..4699109 | Replicon | chromosome |
| Accession | NZ_CP115837 | ||
| Organism | Klebsiella pneumoniae strain MRSN22265 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R4YAY3 |
| Locus tag | KFB76_RS23035 | Protein ID | WP_004178374.1 |
| Coordinates | 4698593..4698877 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | KFB76_RS23040 | Protein ID | WP_002886901.1 |
| Coordinates | 4698867..4699109 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KFB76_RS23010 (KFB76_023005) | 4693983..4694246 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
| KFB76_RS23015 (KFB76_023010) | 4694376..4694549 | + | 174 | WP_032431440.1 | hypothetical protein | - |
| KFB76_RS23020 (KFB76_023015) | 4694552..4695295 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| KFB76_RS23025 (KFB76_023020) | 4695652..4697790 | + | 2139 | WP_004222153.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| KFB76_RS23030 (KFB76_023025) | 4698125..4698589 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| KFB76_RS23035 (KFB76_023030) | 4698593..4698877 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| KFB76_RS23040 (KFB76_023035) | 4698867..4699109 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| KFB76_RS23045 (KFB76_023040) | 4699187..4701097 | - | 1911 | WP_075394523.1 | PRD domain-containing protein | - |
| KFB76_RS23050 (KFB76_023045) | 4701120..4702274 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
| KFB76_RS23055 (KFB76_023050) | 4702341..4703081 | - | 741 | WP_004186692.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T267430 WP_004178374.1 NZ_CP115837:c4698877-4698593 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A6THG1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |